KEGG   Homo sapiens (human): 5868Help
Entry
5868              CDS       T01001                                 

Gene name
RAB5A, RAB5
Definition
(RefSeq) RAB5A, member RAS oncogene family
  KO
K07887  
Ras-related protein Rab-5A
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Endocytosis
Phagosome
Vasopressin-regulated water reabsorption
Amyotrophic lateral sclerosis (ALS)
Amoebiasis
Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5868 (RAB5A)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    5868 (RAB5A)
   04145 Phagosome
    5868 (RAB5A)
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    5868 (RAB5A)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    5868 (RAB5A)
  Infectious diseases
   05152 Tuberculosis
    5868 (RAB5A)
   05146 Amoebiasis
    5868 (RAB5A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    5868 (RAB5A)
 Endosome - Lysosome transport
    5868 (RAB5A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5868 (RAB5A)
  Exosomal proteins of other body fluids (saliva and urine)
   5868 (RAB5A)
  Exosomal proteins of colorectal cancer cells
   5868 (RAB5A)
  Exosomal proteins of bladder cancer cells
   5868 (RAB5A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    5868 (RAB5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p24.3
AA seq 215 aa AA seqDB search
MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR
QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK
LPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggctagtcgaggcgcaacaagacccaacgggccaaatacgggaaataaaatatgccag
ttcaaactagtacttctgggagagtccgctgttggcaaatcaagcctagtgcttcgtttt
gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccaa
actgtatgtcttgatgacactacagtaaagtttgaaatatgggatacagctggtcaagaa
cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat
gatatcacaaatgaggagtcctttgcaagagcaaaaaattgggttaaagaacttcagagg
caagcaagtcctaacattgtaatagctttatcgggaaacaaggccgacctagcaaataaa
agagcagtagatttccaggaagcacagtcctatgcagatgacaatagtttattattcatg
gagacatccgctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaaa
ttgccaaagaatgaaccacaaaatccaggagcaaattctgccagaggaagaggagtagac
cttaccgaacccacacaaccaaccaggaatcagtgttgtagtaactaa

DBGET integrated database retrieval system