KEGG   Homo sapiens (human): 5869Help
Entry
5869              CDS       T01001                                 

Gene name
RAB5B
Definition
RAB5B, member RAS oncogene family
Orthology
K07888  
Ras-related protein Rab-5B
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Endocytosis
Phagosome
Vasopressin-regulated water reabsorption
Amoebiasis
Tuberculosis
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Excretory system; Vasopressin-regulated water reabsorption [PATH:hsa04962]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13
AA seq 215 aa AA seqDB search
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ
SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR
QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK
LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgactagcagaagcacagctaggcccaatgggcaaccccaggccagcaaaatttgccag
ttcaaattggtcctgctgggagaatctgcagtgggaaagtcaagcctggtattacgtttt
gtcaaagggcagttccatgagtaccaggagagcaccattggagcggccttcctcacccag
tccgtttgtctagatgacacaacagtgaagtttgagatctgggacacagctgggcaggag
cgatatcacagcttagcccccatgtactacaggggtgcccaagctgcaatcgtggtttac
gacattactaatcaggaaacctttgcccgagcaaagacatgggtgaaggaactacagcga
caggccagtcctagcatcgttattgccctggcagggaacaaagctgacctggccaacaaa
cgtatggtggagtatgaagaggcccaggcatatgcagatgacaacagcttattgttcatg
gagacttcagccaagacagctatgaacgtgaatgatctcttcctggcaatagctaagaag
ttgccaaagagtgaaccccagaatctgggaggtgcagcaggccgaagccggggtgtggat
ctccatgaacagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system