KEGG   Homo sapiens (human): 5871Help
Entry
5871              CDS       T01001                                 

Gene name
MAP4K2, BL44, GCK, RAB8IP
Definition
mitogen-activated protein kinase kinase kinase kinase 2 (EC:2.7.11.1)
Orthology
K04414  
mitogen-activated protein kinase kinase kinase kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13
AA seq 820 aa AA seqDB search
MALLRDVSLQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQ
EITILRECRHPNVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQIAYVCREA
LKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELTASVAKRRSFIGTPYWMAP
EVAAVERKGGYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKT
RWTQNFHHFLKLALTKNPKKRPTAEKLLQHPFTTQQLPRALLTQLLDKASDPHLGTPSPE
DCELETYDMFPDTIHSRGQHGPAERTPSEIQFHQVKFGAPRRKETDPLNEPWEEEWTLLG
KEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEP
LSSPPGTLPPPPSGPNSSPLLPTAWATMKQREDPERSSCHGLPPTPKVHMGACFSKVFNG
CPLRIHAAVTWIHPVTRDQFLVVGAEEGIYTLNLHELHEDTLEKLISHRCSWLYCVNNVL
LSLSGKSTHIWAHDLPGLFEQRRLQQQVPLSIPTNRLTQRIIPRRFALSTKIPDTKGCLQ
CRVVRNPYTGATFLLAALPTSLLLLQWYEPLQKFLLLKNFSSPLPSPAGMLEPLVLDGKE
LPQVCVGAEGPEGPGCRVLFHVLPLEAGLTPDILIPPEGIPGSAQQVIQVDRDTILVSFE
RCVRIVNMQGEPTATLAPELTFDFPIETVVCLQDSVLAFWSHGMQGRSLDTNEVTQEITD
ETRIFRVLGAHRDIILESIPTDNPEAHSNLYILTGHQSTY
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctgcgggatgtgtcgctgcaggacccgcgggaccgcttcgagctgctgcag
cgcgtgggggccgggacctatggcgacgtctacaaggcccgcgacacggtcacgtccgaa
ctggccgccgtgaagatagtcaagctagacccaggggacgacatcagctccctccagcag
gaaatcaccatcctgcgtgagtgccgccaccccaatgtggtggcctacattggcagctac
ctcaggaatgaccgcttgtggatctgcatggagttctgcggagggggctccctgcaggag
atttaccatgccactgggcccctggaggagcggcagattgcctacgtctgccgagaggca
ctgaaggggctccaccacctgcattctcaggggaagatccacagagacatcaagggagcc
aaccttctcctcactctccagggagatgtcaaactggctgactttggggtgtcaggcgag
ctgacagcgtctgtggccaagaggaggtctttcattgggactccctactggatggctccc
gaggtggctgctgtggagcgcaaaggtggctacaatgagctatgtgacgtctgggccctg
ggcatcactgccattgagctgggcgagctgcagccccctctgttccacctgcaccccatg
agggccctgatgctcatgtcgaagagcagcttccagccgcccaaactgagagataagact
cgctggacccagaatttccaccactttctcaaactggccctgaccaagaatcctaagaag
aggccgacagcagagaagctcctgcagcacccgttcacgactcagcagctccctcgggcc
ctcctcacacagctgctggacaaagccagtgaccctcatctggggaccccctcccctgag
gactgtgagctggagacctatgacatgtttccagacaccattcactcccgggggcagcac
ggcccagccgagaggaccccctcggagatccagtttcaccaggtgaaatttggcgcccca
cgcaggaaggaaactgacccactgaatgagccgtgggaggaagagtggacactactggga
aaggaagagttgagtgggagcctgctgcagtcggtccaggaggccctggaggaaaggagt
ctgactattcggtcagcctcagaattccaggagctggactccccagacgataccatggga
accatcaagcgggccccgttcctagggccactccccactgaccctccagcagaggagcct
ctgtccagtcccccaggaaccctgcccccacctccttcaggccccaacagctccccactg
ctgcccacggcctgggccaccatgaagcagcgggaggatcctgagaggtcatcctgccac
gggctccccccaactcccaaggtgcatatgggcgcctgcttctccaaggtcttcaatggc
tgccccctgcggatccacgctgctgtcacctggattcaccctgttactcgggaccagttc
ctggtggtaggggccgaggaaggcatctacacactcaacctgcatgaactgcatgaggat
acgctggagaagctgatttcacatcgctgctcctggctctactgcgtgaacaacgtgctg
ctgtcactctcagggaaatccacgcacatctgggcccatgacctcccaggcctgtttgag
cagcggaggctacagcaacaggttcccctctccatccccaccaaccgcctcacccagcgc
atcatccccaggcgctttgctctgtccaccaagattcctgacaccaaaggctgcttgcag
tgtcgtgtggtgcggaacccctacacgggtgccaccttcctgctggccgccctgcccacc
agcctgctcctgctgcagtggtatgagccgctgcagaagtttctgctgctgaagaacttc
tccagccctctgcccagcccagctgggatgctggagccgctggtgctggatgggaaggag
ctgccgcaggtgtgtgttggggccgaggggcctgaggggcccggctgccgcgtcctgttc
catgtcctgcccctggaggctggcctgacgcccgacatcctcatcccacctgaggggatc
ccaggctcggcccagcaggtgatccaggtggacagggacacaatcctagtcagctttgaa
cgctgtgtgaggattgtcaacatgcagggcgagcccacggccacactggcacctgagctg
acctttgatttccccatcgagactgtggtgtgcctgcaggacagtgtgctggccttctgg
agccatgggatgcaaggccgaagcctggataccaatgaggtgacccaggagatcacagat
gaaacaaggatcttccgagtgcttggggcccacagagacatcatcctggagagcattccc
actgacaacccagaggcgcacagcaacctctacatcctcacgggccaccagagcacctac
taa

DBGET integrated database retrieval system