KEGG   Homo sapiens (human): 5872Help
Entry
5872              CDS       T01001                                 

Gene name
RAB13
Definition
RAB13, member RAS oncogene family
Orthology
K06109  
Ras-related protein Rab-13
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Class
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21.2
AA seq 122 aa AA seqDB search
MGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAR
EHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKCS
LG
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgggcattatcctagtatacgacatcacggatgagaaatctttcgagaatattcagaac
tggatgaaaagcatcaaggagaatgcctcggctggggtggagcgcctcttgctggggaac
aaatgtgacatggaggccaagaggaaggtgcagaaggagcaggccgataagttggctcga
gagcatggaatccgatttttcgaaactagtgctaaatccagtatgaatgtggatgaggct
tttagttccctggcccgggacatcttgctcaagtcaggaggccggagatcaggaaacggc
aacaagcctcccagtactgacctgaaaacttgtgacaagaagaacaccaacaagtgctcc
ctgggctga

DBGET integrated database retrieval system