KEGG   Homo sapiens (human): 5878Help
Entry
5878              CDS       T01001                                 

Gene name
RAB5C, L1880, RAB5CL, RAB5L, RABL
Definition
(RefSeq) RAB5C, member RAS oncogene family
  KO
K07889  Ras-related protein Rab-5C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04962  Vasopressin-regulated water reabsorption
hsa05146  Amoebiasis
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5878 (RAB5C)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    5878 (RAB5C)
   04145 Phagosome
    5878 (RAB5C)
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    5878 (RAB5C)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    5878 (RAB5C)
   05146 Amoebiasis
    5878 (RAB5C)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    5878 (RAB5C)
 Endosome - Lysosome transport
    5878 (RAB5C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5878 (RAB5C)
  Exosomal proteins of other body fluids (saliva and urine)
   5878 (RAB5C)
  Exosomal proteins of colorectal cancer cells
   5878 (RAB5C)
  Exosomal proteins of bladder cancer cells
   5878 (RAB5C)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    5878 (RAB5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 RsgA_GTPase GTP_EFTU AAA_16
Motif
Other DBs
NCBI-GeneID: 5878
NCBI-ProteinID: NP_004574
OMIM: 604037
HGNC: 9785
Ensembl: ENSG00000108774
Vega: OTTHUMG00000169703
Pharos: P51148(Tbio)
UniProt: P51148 A0A024R1U4
Structure
PDB: 

Jmol
Position
17q21.2
AA seq 216 aa AA seqDB search
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK
KLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtcggggaggcgcagcacgacccaatggaccagctgctgggaacaagatctgt
caatttaagctggttctgctgggggagtctgcggtaggcaaatccagcctcgtcctccgc
tttgtcaagggacagtttcacgagtaccaggagagcacaattggagcggccttcctcaca
cagactgtctgcctggatgacacaacagtcaagtttgagatctgggacacagctggacag
gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc
tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctacag
aggcaggccagccccaacatcgtcattgcactcgcgggtaacaaggcagacctggccagc
aagagagccgtggaattccaggaagcacaagcctatgcagacgacaacagtttgctgttc
atggagacatcagcaaagactgcaatgaacgtgaacgaaatcttcatggcaatagctaag
aagcttcccaagaacgagccccagaatgcaactggtgctccaggccgaaaccgaggtgtg
gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system