KEGG   Homo sapiens (human): 5879Help
Entry
5879              CDS       T01001                                 

Gene name
RAC1, MIG5, Rac-1, TC-25, p21-Rac1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
  KO
K04392  
Ras-related C3 botulinum toxin substrate 1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Sphingolipid signaling pathway
Phagosome
PI3K-Akt signaling pathway
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Adherens junction
Tight junction
Toll-like receptor signaling pathway
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Pancreatic secretion
Amyotrophic lateral sclerosis (ALS)
Bacterial invasion of epithelial cells
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Salmonella infection
Kaposi's sarcoma-associated herpesvirus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Choline metabolism in cancer
Viral myocarditis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5879 (RAC1)
   04015 Rap1 signaling pathway
    5879 (RAC1)
   04010 MAPK signaling pathway
    5879 (RAC1)
   04310 Wnt signaling pathway
    5879 (RAC1)
   04370 VEGF signaling pathway
    5879 (RAC1)
   04071 Sphingolipid signaling pathway
    5879 (RAC1)
   04024 cAMP signaling pathway
    5879 (RAC1)
   04151 PI3K-Akt signaling pathway
    5879 (RAC1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    5879 (RAC1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    5879 (RAC1)
   04520 Adherens junction
    5879 (RAC1)
   04530 Tight junction
    5879 (RAC1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    5879 (RAC1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    5879 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    5879 (RAC1)
   04662 B cell receptor signaling pathway
    5879 (RAC1)
   04664 Fc epsilon RI signaling pathway
    5879 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    5879 (RAC1)
   04670 Leukocyte transendothelial migration
    5879 (RAC1)
   04062 Chemokine signaling pathway
    5879 (RAC1)
  Digestive system
   04972 Pancreatic secretion
    5879 (RAC1)
  Nervous system
   04722 Neurotrophin signaling pathway
    5879 (RAC1)
  Development
   04360 Axon guidance
    5879 (RAC1)
   04380 Osteoclast differentiation
    5879 (RAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5879 (RAC1)
   05231 Choline metabolism in cancer
    5879 (RAC1)
   05205 Proteoglycans in cancer
    5879 (RAC1)
   05203 Viral carcinogenesis
    5879 (RAC1)
   05210 Colorectal cancer
    5879 (RAC1)
   05212 Pancreatic cancer
    5879 (RAC1)
   05211 Renal cell carcinoma
    5879 (RAC1)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    5879 (RAC1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5879 (RAC1)
   05416 Viral myocarditis
    5879 (RAC1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5879 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5879 (RAC1)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5879 (RAC1)
   05132 Salmonella infection
    5879 (RAC1)
   05131 Shigellosis
    5879 (RAC1)
   05100 Bacterial invasion of epithelial cells
    5879 (RAC1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    5879 (RAC1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    5879 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    5879 (RAC1)
  Phagocytosis
   NADPH oxidase complex
    5879 (RAC1)
  Macropinocytosis
   Ras GTPases
    5879 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    5879 (RAC1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5879 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   5879 (RAC1)
  Exosomal proteins of colorectal cancer cells
   5879 (RAC1)
  Exosomal proteins of bladder cancer cells
   5879 (RAC1)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    5879 (RAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P63000(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
7p22.1
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacaaccaatgcatttcctggagaatatatccctactgtctttgacaattat
tctgccaatgttatggtagatggaaaaccggtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgccccctatcctatccgcaaacagatgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgag
gtgcggcaccactgtcccaacactcccatcatcctagtgggaactaaacttgatcttagg
gatgataaagacacgatcgagaaactgaaggagaagaagctgactcccatcacctatccg
cagggtctagccatggctaaggagattggtgctgtaaaatacctggagtgctcggcgctc
acacagcgaggcctcaagacagtgtttgacgaagcgatccgagcagtcctctgcccgcct
cccgtgaagaagaggaagagaaaatgcctgctgttgtaa

KEGG   Homo sapiens (human): 5880Help
Entry
5880              CDS       T01001                                 

Gene name
RAC2, EN-7, Gx, HSPC022, p21-Rac2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
  KO
K07860  
Ras-related C3 botulinum toxin substrate 2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Sphingolipid signaling pathway
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Focal adhesion
Adherens junction
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Choline metabolism in cancer
Viral myocarditis
Fluid shear stress and atherosclerosis
Disease
H00099  
Leukocyte adhesion deficiency (LAD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5880 (RAC2)
   04015 Rap1 signaling pathway
    5880 (RAC2)
   04010 MAPK signaling pathway
    5880 (RAC2)
   04310 Wnt signaling pathway
    5880 (RAC2)
   04370 VEGF signaling pathway
    5880 (RAC2)
   04071 Sphingolipid signaling pathway
    5880 (RAC2)
   04024 cAMP signaling pathway
    5880 (RAC2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5880 (RAC2)
   04520 Adherens junction
    5880 (RAC2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    5880 (RAC2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5880 (RAC2)
   04662 B cell receptor signaling pathway
    5880 (RAC2)
   04664 Fc epsilon RI signaling pathway
    5880 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    5880 (RAC2)
   04670 Leukocyte transendothelial migration
    5880 (RAC2)
   04062 Chemokine signaling pathway
    5880 (RAC2)
  Development
   04360 Axon guidance
    5880 (RAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5880 (RAC2)
   05231 Choline metabolism in cancer
    5880 (RAC2)
   05210 Colorectal cancer
    5880 (RAC2)
   05212 Pancreatic cancer
    5880 (RAC2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5880 (RAC2)
   05416 Viral myocarditis
    5880 (RAC2)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    5880 (RAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P15153(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRACSLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggggccgtgggcaagacctgccttctc
atcagctacaccaccaacgcctttcccggagagtacatccccaccgtgtttgacaactat
tcagccaatgtgatggtggacagcaagccagtgaacctggggctgtgggacactgctggg
caggaggactacgaccgtctccggccgctctcctatccacagacggacgtcttcctcatc
tgcttctccctcgtcagcccagcctcttatgagaacgtccgcgccaagtggttcccagaa
gtgcggcaccactgccccagcacacccatcatcctggtgggcaccaagctggacctgcgg
gacgacaaggacaccatcgagaaactgaaggagaagaagctggctcccatcacctacccg
cagggcctggcactggccaaggagattgactcggtgaaatacctggagtgctcagctctc
acccagagaggcctgaaaaccgtgttcgacgaggccatccgggccgtgctgtgccctcag
cccacgcggcagcagaagcgcgcctgcagcctcctctag

KEGG   Homo sapiens (human): 5881Help
Entry
5881              CDS       T01001                                 

Gene name
RAC3
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
  KO
K07861  
Ras-related C3 botulinum toxin substrate 3
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Sphingolipid signaling pathway
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Focal adhesion
Adherens junction
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Choline metabolism in cancer
Viral myocarditis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5881 (RAC3)
   04015 Rap1 signaling pathway
    5881 (RAC3)
   04010 MAPK signaling pathway
    5881 (RAC3)
   04310 Wnt signaling pathway
    5881 (RAC3)
   04370 VEGF signaling pathway
    5881 (RAC3)
   04071 Sphingolipid signaling pathway
    5881 (RAC3)
   04024 cAMP signaling pathway
    5881 (RAC3)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5881 (RAC3)
   04520 Adherens junction
    5881 (RAC3)
  Cell motility
   04810 Regulation of actin cytoskeleton
    5881 (RAC3)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5881 (RAC3)
   04662 B cell receptor signaling pathway
    5881 (RAC3)
   04664 Fc epsilon RI signaling pathway
    5881 (RAC3)
  Development
   04360 Axon guidance
    5881 (RAC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5881 (RAC3)
   05231 Choline metabolism in cancer
    5881 (RAC3)
   05210 Colorectal cancer
    5881 (RAC3)
   05212 Pancreatic cancer
    5881 (RAC3)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5881 (RAC3)
   05416 Viral myocarditis
    5881 (RAC3)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    5881 (RAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P60763(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.3
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKPGKKCTVF
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgcgtggtggtcggcgacggcgccgtggggaagacatgcttgctg
atcagctacacgaccaacgccttccccggagagtacatccccaccgtttttgacaactac
tctgccaacgtgatggtggacgggaaaccagtcaacttggggctgtgggacacagcgggt
caggaggactacgatcggctgcggccactctcctacccccaaactgacgtctttctgatc
tgcttctctctggtgagcccggcctccttcgagaatgttcgtgccaagtggtacccggag
gtgcggcaccactgcccccacacgcccatcctcctggtgggcaccaagctggacctccgc
gacgacaaggacaccattgagcggctgcgggacaagaagctggcacccatcacctaccca
cagggcctggccatggcccgggagattggctctgtgaaatacctggagtgctcagccctg
acccagcggggcctgaagacagtgtttgacgaggcgatccgcgcggtgctctgcccgccc
ccagtgaagaagccggggaagaagtgcaccgtcttctag

KEGG   Homo sapiens (human): 998Help
Entry
998               CDS       T01001                                 

Gene name
CDC42, CDC42Hs, G25K, TKS
Definition
(RefSeq) cell division cycle 42
  KO
K04393  
cell division control protein 42
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Endocytosis
Axon guidance
VEGF signaling pathway
Focal adhesion
Adherens junction
Tight junction
T cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
GnRH signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Bacterial invasion of epithelial cells
Epithelial cell signaling in Helicobacter pylori infection
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Human papillomavirus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Renal cell carcinoma
Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    998 (CDC42)
   04015 Rap1 signaling pathway
    998 (CDC42)
   04010 MAPK signaling pathway
    998 (CDC42)
   04370 VEGF signaling pathway
    998 (CDC42)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    998 (CDC42)
  Cellular community - eukaryotes
   04510 Focal adhesion
    998 (CDC42)
   04520 Adherens junction
    998 (CDC42)
   04530 Tight junction
    998 (CDC42)
  Cell motility
   04810 Regulation of actin cytoskeleton
    998 (CDC42)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    998 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    998 (CDC42)
   04670 Leukocyte transendothelial migration
    998 (CDC42)
   04062 Chemokine signaling pathway
    998 (CDC42)
  Endocrine system
   04912 GnRH signaling pathway
    998 (CDC42)
  Nervous system
   04722 Neurotrophin signaling pathway
    998 (CDC42)
  Development
   04360 Axon guidance
    998 (CDC42)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    998 (CDC42)
   05205 Proteoglycans in cancer
    998 (CDC42)
   05203 Viral carcinogenesis
    998 (CDC42)
   05212 Pancreatic cancer
    998 (CDC42)
   05211 Renal cell carcinoma
    998 (CDC42)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    998 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    998 (CDC42)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    998 (CDC42)
   05130 Pathogenic Escherichia coli infection
    998 (CDC42)
   05132 Salmonella infection
    998 (CDC42)
   05131 Shigellosis
    998 (CDC42)
   05100 Bacterial invasion of epithelial cells
    998 (CDC42)
   05165 Human papillomavirus infection
    998 (CDC42)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    998 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    998 (CDC42)
  Macropinocytosis
   Ras GTPases
    998 (CDC42)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    998 (CDC42)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   998 (CDC42)
  Exosomal proteins of breast milk
   998 (CDC42)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    998 (CDC42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P60953(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.12
AA seq 191 aa AA seqDB search
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgtgggcgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccatcggaatatgtaccgactgtttttgacaactat
gcagtcacagttatgattggtggagaaccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcttcatttgaaaacgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggactcaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcctatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactt
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system