KEGG   Homo sapiens (human): 5881Help
Entry
5881              CDS       T01001                                 

Gene name
RAC3
Definition
ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
Orthology
K07861  
Ras-related C3 botulinum toxin substrate 3
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Focal adhesion
Adherens junction
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5881 (RAC3)
   04015 Rap1 signaling pathway
    5881 (RAC3)
   04010 MAPK signaling pathway
    5881 (RAC3)
   04310 Wnt signaling pathway
    5881 (RAC3)
   04370 VEGF signaling pathway
    5881 (RAC3)
   04024 cAMP signaling pathway
    5881 (RAC3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    5881 (RAC3)
  Cellular commiunity
   04510 Focal adhesion
    5881 (RAC3)
   04520 Adherens junction
    5881 (RAC3)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5881 (RAC3)
   04662 B cell receptor signaling pathway
    5881 (RAC3)
   04664 Fc epsilon RI signaling pathway
    5881 (RAC3)
  Development
   04360 Axon guidance
    5881 (RAC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5881 (RAC3)
   05210 Colorectal cancer
    5881 (RAC3)
   05212 Pancreatic cancer
    5881 (RAC3)
  Cardiovascular diseases
   05416 Viral myocarditis
    5881 (RAC3)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    5881 (RAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.3
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKPGKKCTVF
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgcgtggtggtcggcgacggcgccgtggggaagacatgcttgctg
atcagctacacgaccaacgccttccccggagagtacatccccaccgtttttgacaactac
tctgccaacgtgatggtggacgggaaaccagtcaacttggggctgtgggacacagcgggt
caggaggactacgatcggctgcggccactctcctacccccaaactgacgtctttctgatc
tgcttctctctggtgagcccggcctccttcgagaatgttcgtgccaagtggtacccggag
gtgcggcaccactgcccccacacgcccatcctcctggtgggcaccaagctggacctccgc
gacgacaaggacaccattgagcggctgcgggacaagaagctggcacccatcacctaccca
cagggcctggccatggcccgggagattggctctgtgaaatacctggagtgctcagccctg
acccagcggggcctgaagacagtgtttgacgaggcgatccgcgcggtgctctgcccgccc
ccagtgaagaagccggggaagaagtgcaccgtcttctag

DBGET integrated database retrieval system