KEGG   Homo sapiens (human): 5885Help
Entry
5885              CDS       T01001                                 

Gene name
RAD21, CDLS4, HR21, HRAD21, MCD1, NXP1, SCC1, hHR21
Definition
RAD21 homolog (S. pombe)
Orthology
K06670  
cohesin complex subunit SCC1
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    5885 (RAD21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q24
AA seq 631 aa AA seqDB search
MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLL
LGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQP
LPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQENDFGDFGMDDREIMREGSAFEDD
DMLVSTTTSNLLLESEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGG
IFDDPPALSEAGVMLPEQPAHDDMDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNE
EEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKL
MMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF
ENPEVPREDQQQQHQQRDVIDEPIIEEPSRLQESVMEASRTNIDESAMPPPPPQGVKRKA
GQIDPEPVMPPQQVEQMEIPPVELPPEEPPNICQLIPELELLPEKEKEKEKEKEDDEEEE
DEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSF
LVLKKQQAIELTQEEPYSDIIATPGPRFHII
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgttctacgcacattttgttctcagtaaaagagggcctctggccaaaatttggctagcg
gcccattgggataagaagctaaccaaagcccatgtgttcgagtgtaatttagagagcagc
gtggagagtatcatctcaccaaaggtgaaaatggcattacggacatcaggacatctctta
ctgggagtagttcgaatctatcacaggaaagccaaataccttcttgcagactgtaatgaa
gcattcattaagataaagatggcttttcggccaggtgtggttgacctgcctgaggaaaat
cgggaagcagcttataatgccattactttacctgaagaatttcatgactttgatcagcca
ctgcctgacttagatgacatcgatgtggcccagcagttcagcttgaatcagagtagagtg
gaagagataaccatgagagaagaagttgggaacatcagtattttacaagaaaatgatttt
ggtgattttggaatggatgatcgtgagataatgagagaaggcagtgcttttgaggatgac
gacatgttagtaagcactactacttctaacctcctattagagtctgaacagagcaccagc
aatctgaatgagaaaattaaccatttagaatatgaagatcaatataaggatgataatttt
ggagaaggaaatgatggtggaatattagatgacaaacttattagtaataatgatggcggt
atctttgatgatccccctgccctctctgaggcaggggtgatgttgccagagcagcctgca
catgacgatatggatgaggatgataatgtatcaatgggtgggcctgatagtcctgattca
gtggatcccgttgaaccaatgccaaccatgactgatcaaacaacacttgttccaaatgag
gaagaagcatttgcattggagcctattgatataactgttaaagaaacaaaagccaagagg
aagaggaagctaattgttgacagtgtcaaagagttggatagcaagacaattagagcccaa
cttagtgattattcagatattgttactactttggatctggcaccgcccaccaagaaattg
atgatgtggaaagagacaggaggagtagaaaaactgttttctttacctgctcagcctttg
tggaataacagactactgaagctctttacacgctgtcttacaccgcttgtaccagaagac
cttagaaaaaggaggaaaggaggagaggcagataatttggatgaattcctcaaagaattt
gaaaatccagaggttcctagagaggaccagcaacagcagcatcagcagcgtgatgttatc
gatgagcccattattgaagagccaagccgcctccaggagtcagtgatggaggccagcaga
acaaacatagatgagtcagctatgcctccaccaccacctcagggagttaagcgaaaagct
ggacaaattgacccagagcctgtgatgcctcctcagcaggtagagcagatggaaatacca
cctgtagagcttcccccagaagaacctccaaatatctgtcagctaataccagagttagaa
cttctgccagaaaaagagaaggagaaagagaaggaaaaagaagatgatgaagaggaagag
gatgaagatgcatcagggggcgatcaagatcaggaagaaagaagatggaacaaaaggact
cagcagatgcttcatggtcttcagcgtgctcttgctaaaactggagctgaatctatcagt
ttgcttgagttatgtcgaaatacgaacagaaaacaagctgccgcaaagttctacagcttc
ttggttcttaaaaagcagcaagctattgagctgacacaggaagaaccgtacagtgacatc
atcgcaacacctggaccaaggttccatattatataa

DBGET integrated database retrieval system