KEGG   Homo sapiens (human): 5887Help
Entry
5887              CDS       T01001                                 

Gene name
RAD23B, HHR23B, HR23B, P58
Definition
(RefSeq) RAD23 homolog B, nucleotide excision repair protein
  KO
K10839  
UV excision repair protein RAD23
Organism
hsa  Homo sapiens (human)
Pathway
Nucleotide excision repair
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5887 (RAD23B)
  Replication and repair
   03420 Nucleotide excision repair
    5887 (RAD23B)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    5887 (RAD23B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      5887 (RAD23B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q31.2
AA seq 409 aa AA seqDB search
MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK
EYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPT
STPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDA
TSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVD
PPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP
ALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYI
QVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcaccctgaagaccctccagcagcagaccttcaagatagacattgaccccgag
gagacggtgaaagcactgaaagagaagattgaatctgaaaaggggaaagatgcctttcca
gtagcaggtcaaaaattaatttatgcaggcaaaatcctcaatgatgatactgctctcaaa
gaatataaaattgatgagaaaaactttgtggtggttatggtgaccaaacccaaagcagtg
tccacaccagcaccagctacaactcagcagtcagctcctgccagcactacagcagttact
tcctccaccaccacaactgtggctcaggctccaacccctgtccctgccttggcccccact
tccacacctgcatccatcactccagcatcagcgacagcatcttctgaacctgcacctgct
agtgcagctaaacaagagaagcctgcagaaaagccagcagagacaccagtggctactagc
ccaacagcaactgacagtacatcgggtgattcttctcggtcaaacctttttgaagatgca
acgagtgcacttgtgacgggtcagtcttacgagaatatggtaactgagatcatgtcaatg
ggctatgaacgagagcaagtaattgcagccctgagagccagtttcaacaaccctgacaga
gcagtggagtatcttttaatgggaatccctggagatagagaaagtcaggctgtggttgac
ccccctcaagcagctagtactggggctcctcagtcttcagcagtggctgcagctgcagca
actacgacagcaacaactacaacaacaagttctggaggacatccccttgaatttttacgg
aatcagcctcagtttcaacagatgagacaaattattcagcagaatccttccttgcttcca
gcgttactacagcagataggtcgagagaatcctcaattacttcagcaaattagccaacac
caggagcattttattcagatgttaaatgaaccagttcaagaagctggtggtcaaggagga
ggaggtggaggtggcagtggaggaattgcagaagctggaagtggtcatatgaactacatt
caagtaacacctcaggaaaaagaagctatagaaaggttaaaggcattaggatttcctgaa
ggacttgtgatacaagcgtattttgcttgtgagaagaatgagaatttggctgccaatttt
cttctacagcagaactttgatgaagattga

DBGET integrated database retrieval system