KEGG   Homo sapiens (human): 5887Help
Entry
5887              CDS       T01001                                 

Gene name
RAD23B, HHR23B, HR23B, P58
Definition
RAD23 homolog B (S. cerevisiae)
Orthology
K10839  
UV excision repair protein RAD23
Organism
hsa  Homo sapiens (human)
Pathway
Nucleotide excision repair
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5887 (RAD23B)
  Replication and repair
   03420 Nucleotide excision repair
    5887 (RAD23B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      5887 (RAD23B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q31.2
AA seq 388 aa AA seqDB search
MVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVS
TPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPAS
AAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMG
YEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAAT
TTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQ
EHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEG
LVIQAYFACEKNENLAANFLLQQNFDED
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagcactgaaagagaagattgaatctgaaaaggggaaagatgcctttccagta
gcaggtcaaaaattaatttatgcaggcaaaatcctcaatgatgatactgctctcaaagaa
tataaaattgatgagaaaaactttgtggtggttatggtgaccaaacccaaagcagtgtcc
acaccagcaccagctacaactcagcagtcagctcctgccagcactacagcagttacttcc
tccaccaccacaactgtggctcaggctccaacccctgtccctgccttggcccccacttcc
acacctgcatccatcactccagcatcagcgacagcatcttctgaacctgcacctgctagt
gcagctaaacaagagaagcctgcagaaaagccagcagagacaccagtggctactagccca
acagcaactgacagtacatcgggtgattcttctcggtcaaacctttttgaagatgcaacg
agtgcacttgtgacgggtcagtcttacgagaatatggtaactgagatcatgtcaatgggc
tatgaacgagagcaagtaattgcagccctgagagccagtttcaacaaccctgacagagca
gtggagtatcttttaatgggaatccctggagatagagaaagtcaggctgtggttgacccc
cctcaagcagctagtactggggctcctcagtcttcagcagtggctgcagctgcagcaact
acgacagcaacaactacaacaacaagttctggaggacatccccttgaatttttacggaat
cagcctcagtttcaacagatgagacaaattattcagcagaatccttccttgcttccagcg
ttactacagcagataggtcgagagaatcctcaattacttcagcaaattagccaacaccag
gagcattttattcagatgttaaatgaaccagttcaagaagctggtggtcaaggaggagga
ggtggaggtggcagtggaggaattgcagaagctggaagtggtcatatgaactacattcaa
gtaacacctcaggaaaaagaagctatagaaaggttaaaggcattaggatttcctgaagga
cttgtgatacaagcgtattttgcttgtgagaagaatgagaatttggctgccaattttctt
ctacagcagaactttgatgaagattga

DBGET integrated database retrieval system