KEGG   Homo sapiens (human): 5889Help
Entry
5889              CDS       T01001                                 

Gene name
RAD51C, BROVCA3, FANCO, R51H3, RAD51L2
Definition
(RefSeq) RAD51 paralog C
  KO
K10870  
RAD51-like protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Homologous recombination
Fanconi anemia pathway
Disease
H00238  
Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    5889 (RAD51C)
   03460 Fanconi anemia pathway
    5889 (RAD51C)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     5889 (RAD51C)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     5889 (RAD51C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q22
AA seq 376 aa AA seqDB search
MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALET
LQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKT
TEICGAPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHL
QLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTELLAQVYLLPDFLSEHSKVRLVI
VDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDRNQALLVPA
LGESWGHAATIRLIFHWDRKQRLATLYKSPSQKECTVLFQIKPQGFRDTVVTSACSLQTE
GSLSTRKRSRDPEEEL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgggaagacgttccgctttgaaatgcagcgggatttggtgagtttcccgctgtct
ccagcggtgcgggtgaagctggtgtctgcggggttccagactgctgaggaactcctagag
gtgaaaccctccgagcttagcaaagaagttgggatatctaaagcagaagccttagaaact
ctgcaaattatcagaagagaatgtctcacaaataaaccaagatatgctggtacatctgag
tcacacaagaagtgtacagcactggaacttcttgagcaggagcatacccagggcttcata
atcaccttctgttcagcactagatgatattcttgggggtggagtgcccttaatgaaaaca
acagaaatttgtggtgcaccaggtgttggaaaaacacaattatgtatgcagttggcagta
gatgtgcagataccagaatgttttggaggagtggcaggtgaagcagtttttattgataca
gagggaagttttatggttgatagagtggtagaccttgctactgcctgcattcagcacctt
cagcttatagcagaaaaacacaagggagaggaacaccgaaaagctttggaggatttcact
cttgataatattctttctcatatttattattttcgctgtcgtgactacacagagttactg
gcacaagtttatcttcttccagatttcctttcagaacactcaaaggttcgactagtgata
gtggatggtattgcttttccatttcgtcatgacctagatgacctgtctcttcgtactcgg
ttattaaatggcctagcccagcaaatgatcagccttgcaaataatcacagattagctgta
attttaaccaatcagatgacaacaaagattgatagaaatcaggccttgcttgttcctgca
ttaggggaaagttggggacatgctgctacaatacggctaatctttcattgggaccgaaag
caaaggttggcaacattgtacaagtcacccagccagaaggaatgcacagtactgtttcaa
atcaaacctcagggatttagagatactgttgttacttctgcatgttcattgcaaacagaa
ggttccttgagcacccggaaacggtcacgagacccagaggaagaattataa

DBGET integrated database retrieval system