KEGG   Homo sapiens (human): 5889Help
Entry
5889              CDS       T01001                                 

Gene name
RAD51C, BROVCA3, FANCO, R51H3, RAD51L2
Definition
RAD51 paralog C
Orthology
K10870  
RAD51-like protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Homologous recombination
Fanconi anemia pathway
Disease
H00238  
Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    5889 (RAD51C)
   03460 Fanconi anemia pathway
    5889 (RAD51C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q22
AA seq 135 aa AA seqDB search
MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALET
LQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKT
TEICGAPGVGKTQLW
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgggaagacgttccgctttgaaatgcagcgggatttggtgagtttcccgctgtct
ccagcggtgcgggtgaagctggtgtctgcggggttccagactgctgaggaactcctagag
gtgaaaccctccgagcttagcaaagaagttgggatatctaaagcagaagccttagaaact
ctgcaaattatcagaagagaatgtctcacaaataaaccaagatatgctggtacatctgag
tcacacaagaagtgtacagcactggaacttcttgagcaggagcatacccagggcttcata
atcaccttctgttcagcactagatgatattcttgggggtggagtgcccttaatgaaaaca
acagaaatttgtggtgcaccaggtgttggaaaaacacaattatggtaa

DBGET integrated database retrieval system