KEGG   Homo sapiens (human): 5890Help
Entry
5890              CDS       T01001                                 

Gene name
RAD51B, R51H2, RAD51L1, REC2
Definition
RAD51 paralog B
Orthology
K10869  
RAD51-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    5890 (RAD51B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q23-q24.2
AA seq 350 aa AA seqDB search
MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRAC
APKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIM
MSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLY
RELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREAS
SLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTW
SHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQAYGNS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcaagaaactaaaacgagtgggtttatcacaagagctgtgtgaccgtctgagt
agacatcagatccttacctgtcaggactttttatgtctttccccactggagcttatgaag
gtgactggtctgagttatcgaggtgtccatgaacttctatgtatggtcagcagggcctgt
gccccaaagatgcaaacggcttatgggataaaagcacaaaggtctgctgatttctcacca
gcattcttatctactaccctttctgctttggacgaagccctgcatggtggtgtggcttgt
ggatccctcacagagattacaggtccaccaggttgtggaaaaactcagttttgtataatg
atgagcattttggctacattacccaccaacatgggaggattagaaggagctgtggtgtac
attgacacagagtctgcatttagtgctgaaagactggttgaaatagcagaatcccgtttt
cccagatattttaacactgaagaaaagttacttttgacaagtagtaaagttcatctttat
cgggaactcacctgtgatgaagttctacaaaggattgaatctttggaagaagaaattatc
tcaaaaggaattaaacttgtgattcttgactctgttgcttctgtggtcagaaaggagttt
gatgcacaacttcaaggcaatctcaaagaaagaaacaagttcttggcaagagaggcatcc
tccttgaagtatttggctgaggagttttcaatcccagttatcttgacgaatcagattaca
acccatctgagtggagccctggcttctcaggcagacctggtgtctccagctgatgatttg
tccctgtctgaaggcacttctggatccagctgtgtgatagccgcactaggaaatacctgg
agtcacagtgtgaatacccggctgatcctccagtaccttgattcagagagaagacagatt
cttattgccaagtcccctctggctcccttcacctcatttgtctacaccatcaaggaggaa
ggcctggttcttcaagcctatggaaattcctag

DBGET integrated database retrieval system