KEGG   Homo sapiens (human): 5890Help
Entry
5890              CDS       T01001                                 

Gene name
RAD51B, R51H2, RAD51L1, REC2
Definition
(RefSeq) RAD51 paralog B
  KO
K10869  RAD51-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    5890 (RAD51B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     5890 (RAD51B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad51 AAA_25 DnaB_C ATPase RecA AAA_24 ATPase_2 AAA AAA_11 SoDot-IcmSS ABC_tran
Motif
Other DBs
NCBI-GeneID: 5890
NCBI-ProteinID: NP_598193
OMIM: 602948
HGNC: 9822
Ensembl: ENSG00000182185
Vega: OTTHUMG00000157530
Pharos: O15315(Tbio)
UniProt: O15315
Position
14q24.1
AA seq 384 aa AA seqDB search
MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRAC
APKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIM
MSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLY
RELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREAS
SLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTW
SHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWA
PEILPPQPPEQLGLQMCHHTQLIF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcaagaaactaaaacgagtgggtttatcacaagagctgtgtgaccgtctgagt
agacatcagatccttacctgtcaggactttttatgtctttccccactggagcttatgaag
gtgactggtctgagttatcgaggtgtccatgaacttctatgtatggtcagcagggcctgt
gccccaaagatgcaaacggcttatgggataaaagcacaaaggtctgctgatttctcacca
gcattcttatctactaccctttctgctttggacgaagccctgcatggtggtgtggcttgt
ggatccctcacagagattacaggtccaccaggttgtggaaaaactcagttttgtataatg
atgagcattttggctacattacccaccaacatgggaggattagaaggagctgtggtgtac
attgacacagagtctgcatttagtgctgaaagactggttgaaatagcagaatcccgtttt
cccagatattttaacactgaagaaaagttacttttgacaagtagtaaagttcatctttat
cgggaactcacctgtgatgaagttctacaaaggattgaatctttggaagaagaaattatc
tcaaaaggaattaaacttgtgattcttgactctgttgcttctgtggtcagaaaggagttt
gatgcacaacttcaaggcaatctcaaagaaagaaacaagttcttggcaagagaggcatcc
tccttgaagtatttggctgaggagttttcaatcccagttatcttgacgaatcagattaca
acccatctgagtggagccctggcttctcaggcagacctggtgtctccagctgatgatttg
tccctgtctgaaggcacttctggatccagctgtgtgatagccgcactaggaaatacctgg
agtcacagtgtgaatacccggctgatcctccagtaccttgattcagagagaagacagatt
cttattgccaagtcccctctggctcccttcacctcatttgtctacaccatcaaggaggaa
ggcctggttcttcaagagacaacattttgctctgtcacccaagctgaactgaactgggct
ccagaaatcctcccacctcagcctcctgagcagctaggactacagatgtgccaccatacc
cagctaattttttaa

DBGET integrated database retrieval system