KEGG   Homo sapiens (human): 5891Help
Entry
5891              CDS       T01001                                 

Gene name
MOK, RAGE, RAGE-1, RAGE1, STK30
Definition
(RefSeq) MOK protein kinase (EC:2.7.11.22)
  KO
K08830  
renal tumor antigen [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     5891 (MOK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  RCK family [OT]
   5891 (MOK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q32
AA seq 419 aa AA seqDB search
MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPH
PNILMLHEVVFDRKSGSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIH
RNGIFHRDVKPENILIKQDVLKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYT
YKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPAQKILTKFKQSRAMNFDFP
FKKGSGIPLLTTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRKTEKRALGSHR
KAGFPEHPVAPEPLSNSCQISKEGRKQKQSLKQEEDRPKRRGPAYVMELPKLKLSGVVRL
SSYSSPTLQSVLGSGTNGRVPVLRPLKCIPASKKTDPQKDLKPAPQQCRLPTIVRKGGR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactataaagcaattggcaaaataggagagggaacgttttctgaagttatgaag
atgcaaagcctgagagatggaaactactatgcatgtaaacaaatgaagcagcgctttgaa
agtattgagcaagtcaacaacctacgagagatccaagcactgaggcgcctgaatccgcac
ccaaacattcttatgttgcatgaagtggtttttgacagaaaatctggttctcttgcacta
atatgtgaacttatggacatgaatatttatgagctaatacgagggagaagatacccatta
tcagaaaaaaaaattatgcactatatgtaccagttatgtaagtccctggatcatattcac
agaaatggaatatttcacagagatgtaaaaccagaaaatatactaataaagcaggatgtc
ctgaaattaggggactttggctcctgccggagtgtctattccaagcagccgtacacggaa
tacatctccacccgctggtaccgggccccggagtgtctcctcactgatgggttctacacg
tacaagatggacctgtggagcgccggctgtgtgttctacgagatcgccagtctgcagccc
ctctttcctggagtaaatgaactggaccaaatctcaaaaatccacgatgtcatcggcaca
cccgctcagaagatcctcaccaagttcaaacagtcgagagctatgaattttgattttcct
tttaaaaagggatcaggaatacctctactaacaaccaatttgtccccacaatgcctctcc
ctcctgcacgcaatggtggcctatgatcccgatgagagaatcgccgcccaccaggccctg
cagcacccctacttccaagaacagaggaaaacagagaagcgggctctgggcagccacaga
aaagctggctttccggagcaccctgtggcaccggaaccactcagtaacagctgccagatt
tccaaggagggcagaaagcagaaacagtccctaaagcaagaggaggaccgtcccaagaga
cgaggaccggcctatgtcatggaactgcccaaactaaagctttcgggagtggtcagactg
tcgtcttactccagccccacgctgcagtccgtgcttggatctggaacaaatggaagagtg
ccggtgctgagacccttgaagtgcatccctgcgagcaagaagacagatccgcagaaggac
cttaagcctgccccgcagcagtgtcgcctgcccaccatagtgcggaaaggcggaagataa

DBGET integrated database retrieval system