KEGG   Homo sapiens (human): 5893Help
Entry
5893              CDS       T01001                                 

Gene name
RAD52, RP11-359B12.2
Definition
RAD52 homolog (S. cerevisiae)
Orthology
K10873  
DNA repair and recombination protein RAD52
Organism
hsa  Homo sapiens (human)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hsa03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13-p12.2
AA seq 418 aa AA seqDB search
MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGG
QKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSY
HEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPR
QLPLEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCS
SRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHST
PVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLAL
NNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggactgaggaagcaattcttggaggacgtgacagccatcctgctgctggcggc
ggctcagtgttatgctttggacagtgccagtacacagcagaagagtaccaggccatccag
aaggccctgaggcagaggctgggcccagaatacataagtagccgcatggctggcggaggc
cagaaggtgtgctacattgagggtcatcgggtaattaatctggccaatgagatgtttggt
tacaatggctgggcacactccatcacgcagcagaatgtggattttgttgacctcaacaat
ggcaagttctacgtgggagtctgtgcatttgtgagggtccagctgaaggatggttcatat
catgaagatgttggttatggtgttagtgagggcctcaagtccaaggctttatctttggag
aaggcaaggaaggaggcggtgacagacgggctgaagcgagccctcaggagttttgggaat
gcacttggaaactgtattctggacaaagactacctgagatcactaaataagcttccacgc
cagttgcctcttgaagtggatttaactaaagcgaagagacaagatcttgaaccgtctgtg
gaggaggcaagatacaacagctgccgaccgaacatggccctgggacacccacagctgcag
caggtgacctccccttccagacccagccatgctgtgataccggcggaccaggactgcagc
tcccgaagcctgagctcatccgccgtggagagcgaggccacgcaccagcggaagctccgg
cagaagcagctgcagcagcagttccgggagcggatggagaagcagcaggttcgagtctcc
acgccgtcagctgagaagagtgaggcagcgcctccggcccctcctgtgacgcacagcact
cctgtaactgtctcagaaccactcctggagaaagacttccttgcaggagtgactcaagaa
ttaatcaagactcttgaagacaactctgaaaagtgggctgtgactcccgatgcaggggat
ggtgtggtcaagccctcgtctagagcagacccagcccagacctctgacacattagccttg
aacaaccagatggtgacccagaacaggactccacacagcgtttgccaccagaaaccacaa
gcaaaatctggatcttgggacctccaaacttatagcgctgaccaacgcacaacaggaaac
tgggaatctcataggaagagccaggacatgaagaaaaggaaatatgatccatcttaa

DBGET integrated database retrieval system