KEGG   Homo sapiens (human): 5893Help
Entry
5893              CDS       T01001                                 

Gene name
RAD52
Definition
RAD52 homolog (S. cerevisiae)
Orthology
K10873  
DNA repair and recombination protein RAD52
Organism
hsa  Homo sapiens (human)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    5893 (RAD52)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13-p12.2
AA seq 418 aa AA seqDB search
MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGG
QKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSY
HEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPR
QLPLEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCS
SRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHST
PVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLAL
NNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggactgaggaagcaattcttggaggacgtgacagccatcctgctgctggcggc
ggctcagtgttatgctttggacagtgccagtacacagcagaagagtaccaggccatccag
aaggccctgaggcagaggctgggcccagaatacataagtagccgcatggctggcggaggc
cagaaggtgtgctacattgagggtcatcgggtaattaatctggccaatgagatgtttggt
tacaatggctgggcacactccatcacgcagcagaatgtggattttgttgacctcaacaat
ggcaagttctacgtgggagtctgtgcatttgtgagggtccagctgaaggatggttcatat
catgaagatgttggttatggtgttagtgagggcctcaagtccaaggctttatctttggag
aaggcaaggaaggaggcggtgacagacgggctgaagcgagccctcaggagttttgggaat
gcacttggaaactgtattctggacaaagactacctgagatcactaaataagcttccacgc
cagttgcctcttgaagtggatttaactaaagcgaagagacaagatcttgaaccgtctgtg
gaggaggcaagatacaacagctgccgaccgaacatggccctgggacacccacagctgcag
caggtgacctccccttccagacccagccatgctgtgataccggcggaccaggactgcagc
tcccgaagcctgagctcatccgccgtggagagcgaggccacgcaccagcggaagctccgg
cagaagcagctgcagcagcagttccgggagcggatggagaagcagcaggttcgagtctcc
acgccgtcagctgagaagagtgaggcagcgcctccggcccctcctgtgacgcacagcact
cctgtaactgtctcagaaccactcctggagaaagacttccttgcaggagtgactcaagaa
ttaatcaagactcttgaagacaactctgaaaagtgggctgtgactcccgatgcaggggat
ggtgtggtcaagccctcgtctagagcagacccagcccagacctctgacacattagccttg
aacaaccagatggtgacccagaacaggactccacacagcgtttgccaccagaaaccacaa
gcaaaatctggatcttgggacctccaaacttatagcgctgaccaacgcacaacaggaaac
tgggaatctcataggaagagccaggacatgaagaaaaggaaatatgatccatcttaa

DBGET integrated database retrieval system