KEGG   Homo sapiens (human): 5897Help
Entry
5897              CDS       T01001                                 

Gene name
RAG2, RAG-2
Definition
recombination activating gene 2
Orthology
K10988  
recombination-activating protein 2
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Primary immunodeficiency
Disease
H00092  
T-B-Severe combined immunodeficiencies (SCIDs)
H00093  
Combined immunodeficiencies (CIDs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    5897 (RAG2)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    5897 (RAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p13
AA seq 527 aa AA seqDB search
MSLQMVTVSNNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHLDVKHNHVKLKPT
IFSKDSCYLPPLRYPATCTFKGSLESEKHQYIIHGGKTPNNEVSDKIYVMSIVCKNNKKV
TFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGVLFGGRSYMPSTHRTTEKWNSVADCLP
CVFLVDFEFGCATSYILPELQDGLSFHVSIAKNDTIYILGGHSLANNIRPANLYRIRVDL
PLGSPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLENQKRMICNIISLEDNKIEIR
EMETPDWTPDIKHSKIWFGSNMGNGTVFLGIPGDNKQVVSEGFYFYMLKCAEDDTNEEQT
TFTNSQTSTEDPGDSTPFEDSEEFCFSAEANSFDGDDEFDTYNEDDEEDESETGYWITCC
PTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNE
HVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPAKKSFLRRLFD
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgcagatggtaacagtcagtaataacatagccttaattcagccaggcttctca
ctgatgaattttgatggacaagttttcttctttggacaaaaaggctggcccaaaagatcc
tgccccactggagttttccatctggatgtaaagcataaccatgtcaaactgaagcctaca
attttctctaaggattcctgctacctccctcctcttcgctacccagccacttgcacattc
aaaggcagcttggagtctgaaaagcatcaatacatcatccatggagggaaaacaccaaac
aatgaggtttcagataagatttatgtcatgtctattgtttgcaagaacaacaaaaaggtt
acttttcgctgcacagagaaagacttggtaggagatgttcctgaagccagatatggtcat
tccattaatgtggtgtacagccgagggaaaagtatgggtgttctctttggaggacgctca
tacatgccttctacccacagaaccacagaaaaatggaatagtgtagctgactgcctgccc
tgtgttttcctggtggattttgaatttgggtgtgctacatcatacattcttccagaactt
caggatgggctatcttttcatgtctctattgccaaaaatgacaccatctatattttagga
ggacattcacttgccaataatatccggcctgccaacctgtacagaataagggttgatctt
cccctgggtagcccagctgtgaattgcacagtcttgccaggaggaatctctgtctccagt
gcaatcctgactcaaactaacaatgatgaatttgttattgttggtggctatcagcttgaa
aatcaaaaaagaatgatctgcaacatcatctctttagaggacaacaagatagaaattcgt
gagatggagaccccagattggaccccagacattaagcacagcaagatatggtttggaagc
aacatgggaaatggaactgtttttcttggcataccaggagacaataaacaagttgtttca
gaaggattctatttctatatgttgaaatgtgctgaagatgatactaatgaagagcagaca
acattcacaaacagtcaaacatcaacagaagatccaggggattccactccctttgaagac
tctgaagaattttgtttcagtgcagaagcaaatagttttgatggtgatgatgaatttgac
acctataatgaagatgatgaagaagatgagtctgagacaggctactggattacatgctgc
cctacttgtgatgtggatatcaacacttgggtaccattctattcaactgagctcaacaaa
cccgccatgatctactgctctcatggggatgggcactgggtccatgctcagtgcatggat
ctggcagaacgcacactcatccatctgtcagcaggaagcaacaagtattactgcaatgag
catgtggagatagcaagagctctacacactccccaaagagtcctacccttaaaaaagcct
ccaatgaaatccctccgtaaaaaaggttctggaaaaatcttgactcctgccaagaaatcc
tttcttagaaggttgtttgattag

DBGET integrated database retrieval system