KEGG   Homo sapiens (human): 5898Help
Entry
5898              CDS       T01001                                 

Gene name
RALA, RAL
Definition
(RefSeq) RALA Ras like proto-oncogene A
  KO
K07834  
Ras-related protein Ral-A
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Phospholipase D signaling pathway
Pathways in cancer
Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5898 (RALA)
   04015 Rap1 signaling pathway
    5898 (RALA)
   04072 Phospholipase D signaling pathway
    5898 (RALA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5898 (RALA)
   05212 Pancreatic cancer
    5898 (RALA)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ral
    5898 (RALA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p15-p13
AA seq 206 aa AA seqDB search
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaataagcccaagggtcagaattctttggctttacacaaagtcatcatggtg
ggcagtggtggcgtgggcaagtcagctctgactctacagttcatgtacgatgagtttgtg
gaggactatgagcctaccaaagcagacagctatcggaagaaggtagtgctagatggggag
gaagtccagatcgatatcttagatacagctgggcaggaggactacgctgcaattagagac
aactacttccgaagtggggaggggttcctctgtgttttctctattacagaaatggaatcc
tttgcagctacagctgacttcagggagcagattttaagagtaaaagaagatgagaatgtt
ccatttctactggttggtaacaaatcagatttagaagataaaagacaggtttctgtagaa
gaggcaaaaaacagagctgagcagtggaatgttaactacgtggaaacatctgctaaaaca
cgagctaatgttgacaaggtattttttgatttaatgagagaaattcgagcgagaaagatg
gaagacagcaaagaaaagaatggaaaaaagaagaggaaaagtttagccaagagaatcaga
gaaagatgctgcattttataa

DBGET integrated database retrieval system