KEGG   Homo sapiens (human): 58985Help
Entry
58985             CDS       T01001                                 

Gene name
IL22RA1, CRF2-9, IL22R, IL22R1
Definition
interleukin 22 receptor, alpha 1
Orthology
K05138  
interleukin 22 receptor alpha 1
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    58985 (IL22RA1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    58985 (IL22RA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.11
AA seq 574 aa AA seqDB search
MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTY
GERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTT
LKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLG
GKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMG
FLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ
YSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVG
PPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLS
SPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNV
LHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPK
DEAKSPAPETSDLEQPTELDSLFRGLALTVQWES
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaggacgctgctgaccatcttgactgtgggatccctggctgctcacgcccctgaggac
ccctcggatctgctccagcacgtgaaattccagtccagcaactttgaaaacatcctgacg
tgggacagcgggccggagggcaccccagacacggtctacagcatcgagtataagacgtac
ggagagagggactgggtggcaaagaagggctgtcagcggatcacccggaagtcctgcaac
ctgacggtggagacgggcaacctcacggagctctactatgccagggtcaccgctgtcagt
gcgggaggccggtcagccaccaagatgactgacaggttcagctctctgcagcacactacc
ctcaagccacctgatgtgacctgtatctccaaagtgagatcgattcagatgattgttcat
cctacccccacgccaatccgtgcaggcgatggccaccggctaaccctggaagacatcttc
catgacctgttctaccacttagagctccaggtcaaccgcacctaccaaatgcaccttgga
gggaagcagagagaatatgagttcttcggcctgacccctgacacagagttccttggcacc
atcatgatttgcgttcccacctgggccaaggagagtgccccctacatgtgccgagtgaag
acactgccagaccggacatggacctactccttctccggagccttcctgttctccatgggc
ttcctcgtcgcagtactctgctacctgagctacagatatgtcaccaagccgcctgcacct
cccaactccctgaacgtccagcgagtcctgactttccagccgctgcgcttcatccaggag
cacgtcctgatccctgtctttgacctcagcggccccagcagtctggcccagcctgtccag
tactcccagatcagggtgtctggacccagggagcccgcaggagctccacagcggcatagc
ctgtccgagatcacctacttagggcagccagacatctccatcctccagccctccaacgtg
ccacctccccagatcctctccccactgtcctatgccccaaacgctgcccctgaggtcggg
cccccatcctatgcacctcaggtgacccccgaagctcaattcccattctacgccccacag
gccatctctaaggtccagccttcctcctatgcccctcaagccactccggacagctggcct
ccctcctatggggtatgcatggaaggttctggcaaagactcccccactgggacactttct
agtcctaaacaccttaggcctaaaggtcagcttcagaaagagccaccagctggaagctgc
atgttaggtggcctttctctgcaggaggtgacctccttggctatggaggaatcccaagaa
gcaaaatcattgcaccagcccctggggatttgcacagacagaacatctgacccaaatgtg
ctacacagtggggaggaagggacaccacagtacctaaagggccagctccccctcctctcc
tcagtccagatcgagggccaccccatgtccctccctttgcaacctccttcccgtccatgt
tccccctcggaccaaggtccaagtccctggggcctgctggagtcccttgtgtgtcccaag
gatgaagccaagagcccagcccctgagacctcagacctggagcagcccacagaactggat
tctcttttcagaggcctggccctgactgtgcagtgggagtcctga

DBGET integrated database retrieval system