KEGG   Homo sapiens (human): 5899Help
Entry
5899              CDS       T01001                                 

Gene name
RALB
Definition
v-ral simian leukemia viral oncogene homolog B
Orthology
K07835  
Ras-related protein Ral-B
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Pathways in cancer
Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5899 (RALB)
   04015 Rap1 signaling pathway
    5899 (RALB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5899 (RALB)
   05212 Pancreatic cancer
    5899 (RALB)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ral
    5899 (RALB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q14.2
AA seq 206 aa AA seqDB search
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDK
IPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKK
MSENKDKNGKKSSKNKKSFKERCCLL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaacaagagtaagggccagagctccttggccctccacaaggtgatcatggtt
ggcagcggaggcgttggcaagtcagccctgacgcttcagttcatgtatgacgagtttgta
gaagactatgaacctaccaaagctgacagttatagaaagaaagtggttcttgatggggaa
gaagttcagatagatattctggacaccgctgggcaagaggactacgcagccattcgagat
aactactttcggagtggggaagggtttcttcttgtgttctcaatcacagaacatgaatcc
tttacagcaactgccgaattcagggaacagattctccgtgtgaaggctgaagaagataaa
attccactgctcgtcgtgggaaacaagtctgacctagaggagcggaggcaggtgcctgtg
gaggaggccaggagtaaagccgaagagtggggcgtgcagtacgtggagacgtcagcgaag
acccgggccaacgtggacaaggtgttctttgacctaatgagagaaatcagaacaaagaag
atgtcagaaaacaaagacaagaatggcaagaaaagcagcaagaacaagaaaagttttaaa
gaaagatgttgcttactatga

DBGET integrated database retrieval system