KEGG   Homo sapiens (human): 590Help
Entry
590               CDS       T01001                                 

Gene name
BCHE, CHE1, CHE2, E1
Definition
(RefSeq) butyrylcholinesterase
  KO
K01050  cholinesterase [EC:3.1.1.8]
Organism
hsa  Homo sapiens (human)
Drug target
Fluostigmine: D00043
Rivastigmine (DG00984): D02558 D03822
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.8  cholinesterase
     590 (BCHE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase AChE_tetra Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 590
NCBI-ProteinID: NP_000046
OMIM: 177400
HGNC: 983
Ensembl: ENSG00000114200
Vega: OTTHUMG00000158131
Pharos: P06276(Tclin)
UniProt: P06276
Structure
PDB: 

Jmol
Position
3q26.1
AA seq 602 aa AA seqDB search
MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIP
YAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDC
LYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALG
FLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPG
SHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEI
LLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVY
GAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDV
VGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLER
RDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMT
KLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCV
GL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcatagcaaagtcacaatcatatgcatcagatttctcttttggtttcttttgctctgc
atgcttattgggaagtcacatactgaagatgacatcataattgcaacaaagaatggaaaa
gtcagagggatgaacttgacagtttttggtggcacggtaacagcctttcttggaattccc
tatgcacagccacctcttggtagacttcgattcaaaaagccacagtctctgaccaagtgg
tctgatatttggaatgccacaaaatatgcaaattcttgctgtcagaacatagatcaaagt
tttccaggcttccatggatcagagatgtggaacccaaacactgacctcagtgaagactgt
ttatatctaaatgtatggattccagcacctaaaccaaaaaatgccactgtattgatatgg
atttatggtggtggttttcaaactggaacatcatctttacatgtttatgatggcaagttt
ctggctcgggttgaaagagttattgtagtgtcaatgaactatagggtgggtgccctagga
ttcttagctttgccaggaaatcctgaggctccagggaacatgggtttatttgatcaacag
ttggctcttcagtgggttcaaaaaaatatagcagcctttggtggaaatcctaaaagtgta
actctctttggagaaagtgcaggagcagcttcagttagcctgcatttgctttctcctgga
agccattcattgttcaccagagccattctgcaaagtggatcctttaatgctccttgggcg
gtaacatctctttatgaagctaggaacagaacgttgaacttagctaaattgactggttgc
tctagagagaatgagactgaaataatcaagtgtcttagaaataaagatccccaagaaatt
cttctgaatgaagcatttgttgtcccctatgggactcctttgtcagtaaactttggtccg
accgtggatggtgattttctcactgacatgccagacatattacttgaacttggacaattt
aaaaaaacccagattttggtgggtgttaataaagatgaagggacagcttttttagtctat
ggtgctcctggcttcagcaaagataacaatagtatcataactagaaaagaatttcaggaa
ggtttaaaaatattttttccaggagtgagtgagtttggaaaggaatccatcctttttcat
tacacagactgggtagatgatcagagacctgaaaactaccgtgaggccttgggtgatgtt
gttggggattataatttcatatgccctgccttggagttcaccaagaagttctcagaatgg
ggaaataatgcctttttctactattttgaacaccgatcctccaaacttccgtggccagaa
tggatgggagtgatgcatggctatgaaattgaatttgtctttggtttacctctggaaaga
agagataattacacaaaagccgaggaaattttgagtagatccatagtgaaacggtgggca
aattttgcaaaatatgggaatccaaatgagactcagaacaatagcacaagctggcctgtc
ttcaaaagcactgaacaaaaatatctaaccttgaatacagagtcaacaagaataatgacg
aaactacgtgctcaacaatgtcgattctggacatcattttttccaaaagtcttggaaatg
acaggaaatattgatgaagcagaatgggagtggaaagcaggattccatcgctggaacaat
tacatgatggactggaaaaatcaatttaacgattacactagcaagaaagaaagttgtgtg
ggtctctaa

DBGET integrated database retrieval system