KEGG   Homo sapiens (human): 5900Help
Entry
5900              CDS       T01001                                 

Gene name
RALGDS, RGDS, RGF, RalGEF
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05231  Choline metabolism in cancer
Network
N00103  EGF-EGFR-RAS-RalGDS signaling pathway
N00104  Mutation-activated KRAS to RalGDS signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5900 (RALGDS)
   04015 Rap1 signaling pathway
    5900 (RALGDS)
   04072 Phospholipase D signaling pathway
    5900 (RALGDS)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5900 (RALGDS)
   05231 Choline metabolism in cancer
    5900 (RALGDS)
   05210 Colorectal cancer
    5900 (RALGDS)
   05212 Pancreatic cancer
    5900 (RALGDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RA
Motif
Other DBs
NCBI-GeneID: 5900
NCBI-ProteinID: NP_006257
OMIM: 601619
HGNC: 9842
Ensembl: ENSG00000160271
Vega: OTTHUMG00000020858
Pharos: Q12967(Tbio)
UniProt: Q12967 Q8N4Y1
Structure
PDB: 

Jmol
Position
9q34.13-q34.2
AA seq 914 aa AA seqDB search
MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRP
ESSTQEIGEELINGVIYSISLRKVQLHHGGNKGQRWLGYENESALNLYETCKVRTVKAGT
LEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCIL
PYSDEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERR
AHLLLAQLEHSEPIEAEPEALSPVPALKPTPELELALTPARAPSPVPAPAPEPEPAPTPA
PGSELEVAPAPAPELQQAPEPAVGLESAPAPALELEPAPEQDPAPSQTLELEPAPAPVPS
LQPSWPSPVVAENGLSEEKPHLLVFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDK
KGKEHLAPTIRATVTQFNSVANCVITTCLGNRSTKAPDRARVVEHWIEVARECRILKNFS
SLYAILSALQSNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKF
ATLEMNPKRAQKRPKETGIIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFE
VIAQIKLLQSACNNYSIAPDEQFGAWFRAVERLSETESYNLSCELEPPSESASNTLRTKK
NTAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPYLSSGDIADALSVHSAGSSSSDVE
EINISFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVAATRTHKRSVS
GLCNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEE
EEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLP
RMKQKGLKIAKGIF
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagcgcatgtgggccgaggcggccgggcctgctggcggcgccgagccgctgttt
ccgggctcccggcggagccgcagcgtgtgggacgccgtgcgcctggaggtgggcgtcccc
gacagctgcccggtggtgctgcacagcttcacgcagctagaccccgacctgccgcgcccg
gagagctccacgcaggagatcggtgaggagctgatcaacggagtcatctactccatctcc
ctgcgcaaggtgcagctgcaccacggaggcaacaaggggcagcgctggctcgggtatgag
aatgagtcggccctgaacctttatgagacttgcaaggtgcggaccgtgaaggctggcacg
ctggagaagctggtggagcacctggtgccagccttccagggcagcgacctctcctacgtc
accatcttcctgtgtacctatagagccttcaccaccacccaacaggtcctggacctgctg
ttcaaaaggtacggtagatgtgacgccctcacggcctcctctagatacggctgcatcctc
ccctattccgacgaggatggtggaccccaggaccaacttaaaaatgccatctcctccatc
ctgggcacctggctggaccagtactcggaggatttctgtcaacctccggactttccctgc
ctcaagcagctggtggcctacgtgcagctcaacatgccaggctcagacctggagcgccgt
gcccaccttctcctggcccagctggagcactcggaacccattgaggcagagcctgaggct
ctgtcaccagtgccagctctaaaaccaactccagagctcgagctagctctaacaccagct
cgagcacccagcccagtgccggctccagccccggagccagagccagctccaacaccagct
ccaggttcagagctagaagtagctccagcaccagctccggagctccagcaggctccagag
ccagctgtgggactagaatcggctccagcgccagctctggaactagagccagctccagaa
caggatccagctccctcacaaactctagagctggagccagctccagcaccagttccatca
ttacagccttcctggccttcacctgtggttgcagagaacgggctgagtgaggagaagcct
cacctcttggtgttccctccagatctggtggcagagcagtttacactgatggatgcggaa
ctgttcaagaaggtggtgccctaccactgcctgggctccatctggtcccagcgggacaag
aagggcaaggagcacctggcgcccaccatccgcgccactgtcacccagttcaacagtgtg
gccaactgtgtcatcaccacctgcctcgggaaccgaagcacgaaagccccagacagggcc
agggtggtggagcactggatcgaggtggccagggagtgccggatcctcaagaacttctcg
tcactgtatgccatcctctctgccctgcagagcaactccatccaccgtctgaagaagacg
tgggaagacgtttccagggacagtttccggatctttcagaagctgtcagagatcttctca
gatgagaacaactactcattgagccgggagctgctcatcaaggagggcacctccaagttt
gccaccctggagatgaaccccaagagagcccagaaacggccgaaggagacgggcatcatc
cagggcaccgttccctacctgggcacgttcctcaccgacctggtgatgctggacactgcc
atgaaggactatctgtatggcagactcatcaactttgagaagaggaggaaggagttcgag
gtgatcgcccagatcaagctgctgcagtcggcctgcaacaactacagcatcgcgccagat
gagcaatttggggcctggttccgggccgtggagcggctcagcgagactgagagctacaac
ctgtcgtgcgagctggagcccccatccgagtcagccagcaacaccctcaggaccaagaag
aacacagccattgtcaagcgctggagcgaccgccaggcccccagcactgagctcagtacc
agtggcagctcccactccaagtcctgtgaccagctcaggtgtggcccctacctcagcagc
ggggacatcgctgacgcgctcagcgtgcactcggccggctcctctagctccgacgtggag
gagatcaacatcagcttcgtcccggagtctcctgatggccaggaaaagaagttctgggaa
tcagcctcacagtcatccccggagacctccggcatcagctcagcctccagcagcacctcg
tcctcctcagcctccaccacgcccgtggctgccacacgcacccacaagcgctctgtctca
gggctctgcaactccagctccgcgctgccgctctacaaccagcaggtgggcgactgctgt
atcatccgcgtcagcctggacgtggacaatggcaacatgtacaagagcatcctggtgacc
agccaagataaggctccggctgtaatccgcaaggccatggacaaacacaacctggaggag
gaggagccggaggactatgagctgctgcagattctctcagatgaccggaagctgaagatc
cctgaaaacgccaacgtcttctatgccatgaactctaccgccaactatgactttgtcctc
aagaagcggaccttcaccaagggagtgaaggtcaagcacggagccagctccaccctccct
cgcatgaagcagaaaggactcaagattgccaagggcatcttctga

DBGET integrated database retrieval system