KEGG   Homo sapiens (human): 5900Help
Entry
5900              CDS       T01001                                 

Gene name
RALGDS, RGDS, RGF, RalGEF
Definition
ral guanine nucleotide dissociation stimulator
Orthology
K08732  
ral guanine nucleotide dissociation stimulator
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5900 (RALGDS)
   04015 Rap1 signaling pathway
    5900 (RALGDS)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5900 (RALGDS)
   05210 Colorectal cancer
    5900 (RALGDS)
   05212 Pancreatic cancer
    5900 (RALGDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.3
AA seq 859 aa AA seqDB search
MMVDCQSSTQEIGEELINGVIYSISLRKVQLHHGGNKGQRWLGYENESALNLYETCKVRT
VKAGTLEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSR
YGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGS
DLERRAHLLLAQLEHSEPIEAEPEALSPVPALKPTPELELALTPARAPSPVPAPAPEPEP
APTPAPGSELEVAPAPAPELQQAPEPAVGLESAPAPALELEPAPEQDPAPSQTLELEPAP
APVPSLQPSWPSPVVAENGLSEEKPHLLVFPPDLVAEQFTLMDAELFKKVVPYHCLGSIW
SQRDKKGKEHLAPTIRATVTQFNSVANCVITTCLGNRSTKAPDRARVVEHWIEVARECRI
LKNFSSLYAILSALQSNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKE
GTSKFATLEMNPKRAQKRPKETGIIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKR
RKEFEVIAQIKLLQSACNNYSIAPDEQFGAWFRAVERLSETESYNLSCELEPPSESASNT
LRTKKNTAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPYLSSGDIADALSVHSAGSS
SSDVEEINISFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVAATRTH
KRSVSGLCNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDK
HNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGA
SSTLPRMKQKGLKIAKGIF
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgatggtagattgccagagctccacgcaggagatcggtgaggagctgatcaacggagtc
atctactccatctccctgcgcaaggtgcagctgcaccacggaggcaacaaggggcagcgc
tggctcgggtatgagaatgagtcggccctgaacctttatgagacttgcaaggtgcggacc
gtgaaggctggcacgctggagaagctggtggagcacctggtgccagccttccagggcagc
gacctctcctacgtcaccatcttcctgtgtacctatagagccttcaccaccacccaacag
gtcctggacctgctgttcaaaaggtacggtagatgtgacgccctcacggcctcctctaga
tacggctgcatcctcccctattccgacgaggatggtggaccccaggaccaacttaaaaat
gccatctcctccatcctgggcacctggctggaccagtactcggaggatttctgtcaacct
ccggactttccctgcctcaagcagctggtggcctacgtgcagctcaacatgccaggctca
gacctggagcgccgtgcccaccttctcctggcccagctggagcactcggaacccattgag
gcagagcctgaggctctgtcaccagtgccagctctaaaaccaactccagagctcgagcta
gctctaacaccagctcgagcacccagcccagtgccggctccagccccggagccagagcca
gctccaacaccagctccaggttcagagctagaagtagctccagcaccagctccggagctc
cagcaggctccagagccagctgtgggactagaatcggctccagcgccagctctggaacta
gagccagctccagaacaggatccagctccctcacaaactctagagctggagccagctcca
gcaccagttccatcattacagccttcctggccttcacctgtggttgcagagaacgggctg
agtgaggagaagcctcacctcttggtgttccctccagatctggtggcagagcagtttaca
ctgatggatgcggaactgttcaagaaggtggtgccctaccactgcctgggctccatctgg
tcccagcgggacaagaagggcaaggagcacctggcgcccaccatccgcgccactgtcacc
cagttcaacagtgtggccaactgtgtcatcaccacctgcctcgggaaccgaagcacgaaa
gccccagacagggccagggtggtggagcactggatcgaggtggccagggagtgccggatc
ctcaagaacttctcgtcactgtatgccatcctctctgccctgcagagcaactccatccac
cgtctgaagaagacgtgggaagacgtttccagggacagtttccggatctttcagaagctg
tcagagatcttctcagatgagaacaactactcattgagccgggagctgctcatcaaggag
ggcacctccaagtttgccaccctggagatgaaccccaagagagcccagaaacggccgaag
gagacgggcatcatccagggcaccgttccctacctgggcacgttcctcaccgacctggtg
atgctggacactgccatgaaggactatctgtatggcagactcatcaactttgagaagagg
aggaaggagttcgaggtgatcgcccagatcaagctgctgcagtcggcctgcaacaactac
agcatcgcgccagatgagcaatttggggcctggttccgggccgtggagcggctcagcgag
actgagagctacaacctgtcgtgcgagctggagcccccatccgagtcagccagcaacacc
ctcaggaccaagaagaacacagccattgtcaagcgctggagcgaccgccaggcccccagc
actgagctcagtaccagtggcagctcccactccaagtcctgtgaccagctcaggtgtggc
ccctacctcagcagcggggacatcgctgacgcgctcagcgtgcactcggccggctcctct
agctccgacgtggaggagatcaacatcagcttcgtcccggagtctcctgatggccaggaa
aagaagttctgggaatcagcctcacagtcatccccggagacctccggcatcagctcagcc
tccagcagcacctcgtcctcctcagcctccaccacgcccgtggctgccacacgcacccac
aagcgctctgtctcagggctctgcaactccagctccgcgctgccgctctacaaccagcag
gtgggcgactgctgtatcatccgcgtcagcctggacgtggacaatggcaacatgtacaag
agcatcctggtgaccagccaagataaggctccggctgtaatccgcaaggccatggacaaa
cacaacctggaggaggaggagccggaggactatgagctgctgcagattctctcagatgac
cggaagctgaagatccctgaaaacgccaacgtcttctatgccatgaactctaccgccaac
tatgactttgtcctcaagaagcggaccttcaccaagggagtgaaggtcaagcacggagcc
agctccaccctccctcgcatgaagcagaaaggactcaagattgccaagggcatcttctga

DBGET integrated database retrieval system