KEGG   Homo sapiens (human): 5901Help
Entry
5901              CDS       T01001                                 

Gene name
RAN, ARA24, Gsp1, TC4
Definition
RAN, member RAS oncogene family
Orthology
K07936  
GTP-binding nuclear protein Ran
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
HTLV-I infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    5901 (RAN)
   03008 Ribosome biogenesis in eukaryotes
    5901 (RAN)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    5901 (RAN)
   05169 Epstein-Barr virus infection
    5901 (RAN)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA transport factors
   tRNA export factors
    5901 (RAN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5901 (RAN)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ran Family
   Ran
    5901 (RAN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.3
AA seq 128 aa AA seqDB search
MFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYD
ISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTA
LPDEDDDL
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgtaacatcgagagttacttacaagaatgtgcctaactggcatagagatctg
gtacgagtgtgtgaaaacatccccattgtgttgtgtggcaacaaagtggatattaaggac
aggaaagtgaaggcgaaatccattgtcttccaccgaaagaagaatcttcagtactacgac
atttctgccaaaagtaactacaactttgaaaagcccttcctctggcttgctaggaagctc
attggagaccctaacttggaatttgttgccatgcctgctctcgccccaccagaagttgtc
atggacccagctttggcagcacagtatgagcacgacttagaggttgctcagacaactgct
ctcccggatgaggatgatgacctgtga

DBGET integrated database retrieval system