KEGG   Homo sapiens (human): 5902Help
Entry
5902              CDS       T01001                                 

Gene name
RANBP1, HTF9A
Definition
RAN binding protein 1
Orthology
K15306  
Ran-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    5902 (RANBP1)
  Infectious diseases
   05166 HTLV-I infection
    5902 (RANBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q11.21
AA seq 278 aa AA seqDB search
MGSALGRARRTLSGRPFQRAPCKTRRALSLSAALRNVTKAQGGCPKSLVLWGCRPKRPRK
RRTSLKLAWRGTFCSSSLKISEDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKTLEE
DEEELFKMRAKLFRFASENDLPEWKERGTGDVKLLKHKEKGAIRLLMRRDKTLKICANHY
ITPMMELKPNAGSDRAWVWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIE
EREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEKQ
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggggtcggccttgggccgggccaggcgcacactgagtgggcggcctttccagagggca
ccatgcaaaacgcgcagggccttgtccctctctgcagcgctgcggaatgtcacaaaggcg
cagggtggttgcccaaagagtttggttttgtggggctgcagaccaaagcggcccaggaag
cgccggacgtcgctgaagctggcgtggcgaggcacgttctgcagctccagtttaaagatc
tcagaggacactcatgaggaccatgatacttccactgagaatacagacgagtccaaccat
gaccctcagtttgagccaatagtttctcttcctgagcaagaaattaaaacactggaagaa
gatgaagaggaactttttaaaatgcgggcaaaactgttccgatttgcctctgagaacgat
ctcccagaatggaaggagcgaggcactggtgacgtcaagctcctgaagcacaaggagaaa
ggggccatccgcctcctcatgcggagggacaagaccctgaagatctgtgccaaccactac
atcacgccgatgatggagctgaagcccaacgcaggtagcgaccgtgcctgggtctggaac
acccacgctgacttcgccgacgagtgccccaagccagagctgctggccatccgcttcctg
aatgctgagaatgcacagaaattcaaaacaaagtttgaagaatgcaggaaagagatcgaa
gagagagaaaagaaagcaggatcaggcaaaaatgatcatgccgaaaaagtggcggaaaag
ctagaagctctctcggtgaaggaggagaccaaggaggatgctgaggagaagcaataa

DBGET integrated database retrieval system