KEGG   Homo sapiens (human): 5905Help
Entry
5905              CDS       T01001                                 

Gene name
RANGAP1, Fug1, RANGAP, SD
Definition
Ran GTPase activating protein 1
Orthology
K14319  
Ran GTPase-activating protein 1
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13
AA seq 587 aa AA seqDB search
MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNT
VGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLS
DNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPL
ALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGINHPGITALAQAFAVNPLLRV
INLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNL
SFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDD
EDEEEEEEGEEEEEEAEEEEEEDEEEEEEEEEEEEEEPQQRGQGEKSATPSRKILDPNTG
EPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVF
KDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLM
ALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggaagacattgccaagctggcagagacacttgccaagactcaggtggccggg
ggacagctgagtttcaaaggcaagagcctcaaactcaacactgcagaagatgctaaagat
gtgattaaagagattgaagactttgacagcttggaggctctgcgtctggaaggcaacaca
gtgggcgtggaagcagccagggtcatcgccaaggccttagagaagaagtcggagttgaag
cgctgccactggagtgacatgttcacgggaaggctgcggaccgagatcccaccagccctg
atctcactaggggaaggactcatcacagctggggctcagctggtggagctggacttaagc
gacaacgcattcgggcccgacggtgtgcaaggcttcgaggccctgctcaagagctcagcc
tgcttcaccctgcaggaactcaagctcaacaactgtggcatgggcattggcggcggcaag
atcctggctgcagctctgaccgaatgtcaccggaaatccagtgcccaaggcaagcctctg
gccctgaaggtctttgtggctggcagaaaccgtctggagaatgatggcgccactgccttg
gcagaagcttttagggtcatcgggaccctggaggaggtccacatgccacagaatgggatc
aaccaccctggcatcactgccctggcccaggctttcgctgtcaaccccctgctgcgggtc
atcaacctgaatgacaacaccttcactgagaagggcgccgtggccatggccgagaccttg
aagaccttgcggcaggtggaggtgattaattttggggactgcctggtgcgctccaagggt
gcagttgccattgcagatgccatccgcggcggcctgcccaagctaaaggagctgaacttg
tcattctgtgaaatcaagagggatgctgccctggctgttgctgaggccatggcagacaaa
gctgagctggagaagctggacctgaatggcaacaccctgggagaagaaggctgtgaacag
cttcaggaggtgctggagggcttcaacatggccaaggtgctggcgtccctcagtgatgac
gaggacgaggaggaggaggaggaaggagaagaggaagaagaggaagcagaagaagaggag
gaggaagatgaggaagaggaggaagaagaggaggaggaggaggaagaagagcctcagcag
cgagggcagggagagaagtcagccacgccctcacggaagattctggaccctaacactggg
gagccagctcccgtgctgtcctccccacctcctgcagacgtctccaccttcctggctttt
ccctctccagagaagctgctgcgcctagggcccaagagctccgtgctgatagcccagcag
actgacacgtctgaccccgagaaggtggtctctgccttcctaaaggtgtcatctgtgttc
aaggacgaagctactgtgaggatggcagtgcaggatgcagtagatgccctgatgcagaag
gctttcaactcctcgtccttcaactccaacaccttcctcaccaggctgctcgtgcacatg
ggtctgctcaagagtgaagacaaggtcaaggccattgccaacctgtacggccccctgatg
gcgctgaaccacatggtgcagcaggactatttccccaaggcccttgcacccctgctgctg
gcgttcgtgaccaagcccaacagcgccctggaatcctgctccttcgcccgccacagtctg
ctgcagacgctgtacaaggtctag

DBGET integrated database retrieval system