KEGG   Homo sapiens (human): 59067Help
Entry
59067             CDS       T01001                                 

Gene name
IL21, CVID11, IL-21, Za11
Definition
interleukin 21
Orthology
K05434  
interleukin 21
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Inflammatory bowel disease (IBD)
Disease
H00408  
Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    59067 (IL21)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    59067 (IL21)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    59067 (IL21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q26-q27
AA seq 153 aa AA seqDB search
MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEF
LPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRL
TCPSCDSYEKKPPKEFLERFKSLLQKVSTLSFI
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagatccagtcctggcaacatggagaggattgtcatctgtctgatggtcatcttcttg
gggacactggtccacaaatcaagctcccaaggtcaagatcgccacatgattagaatgcgt
caacttatagatattgttgatcagctgaaaaattatgtgaatgacttggtccctgaattt
ctgccagctccagaagatgtagagacaaactgtgagtggtcagctttttcctgctttcag
aaggcccaactaaagtcagcaaatacaggaaacaatgaaaggataatcaatgtatcaatt
aaaaagctgaagaggaaaccaccttccacaaatgcagggagaagacagaaacacagacta
acatgcccttcatgtgattcttatgagaaaaaaccacccaaagaattcctagaaagattc
aaatcacttctccaaaaggtatctaccttaagtttcatttga

DBGET integrated database retrieval system