KEGG   Homo sapiens (human): 59082Help
Entry
59082             CDS       T01001                                 

Gene name
CARD18, ICEBERG, UNQ5804, pseudo-ICE
Definition
(RefSeq) caspase recruitment domain family member 18
  KO
K12806  
caspase recruitment domain-containing protein 16/17/18
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    59082 (CARD18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P57730(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
11q22.3
AA seq 90 aa AA seqDB search
MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDL
VTGKGPKSCCKFIKHLCEEDPQLASKMGLH
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccaactcttgcgtaaaaagagaagaatttttatccattcagtgggtgcaggc
acaataaatgccttgctggattgcctattagaggatgaagttattagccaggaagacatg
aacaaagtgagagatgaaaatgacactgtcatggataaggctcgagtcttgattgacctt
gttactggaaaaggacccaagtcttgctgcaaatttatcaagcatctctgtgaagaagac
cctcaacttgcctcaaagatgggtttgcactaa

DBGET integrated database retrieval system