KEGG   Homo sapiens (human): 5913Help
Entry
5913              CDS       T01001                                 

Gene name
RAPSN, RAPSYN, RNF205
Definition
receptor-associated protein of the synapse
Organism
hsa  Homo sapiens (human)
Disease
H00770  
Congenital myasthenic syndrome
H00987  
Fetal akinesia deformation sequence (FADS)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p11.2
AA seq 412 aa AA seqDB search
MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLVTAHSEMGRYK
EMLKFAVVQIDTARELEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQ
LGGQVSLSMGNAFLGLSVFQKALESFEKALRYAHNNDDAMLECRVCCSLGSFYAQVKDYE
KALFFPCKAAELVNNYGKGWSLKYRAMSQYHMAVAYRLLGRLGSAMECCEESMKIALQHG
DRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARK
ALDKALDAIERAQDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRAHVVRFHECVEETE
LYCGLCGESIGEKNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggaccagaccaagcagcagatcgagaaggggctccagctgtaccagtccaac
cagacagagaaggcattgcaggtgtggacaaaggtgctggagaagagctcggacctcatg
gggcgcttccgcgtgctgggctgcctggtcacagcccactcggagatgggccgctacaag
gagatgctgaagttcgctgtggtccagatcgacacggcccgggagctggaggatgccgac
ttcctcctggagagctacctgaacctggcacgcagcaacgagaagctgtgcgagtttcac
aagaccatctcctactgcaagacctgccttgggctgcctggtaccagggcaggtgcccag
ctcggaggccaggtcagcctgagcatgggcaatgccttcctgggcctcagcgtcttccag
aaggccctggagagcttcgagaaggccctgcgctatgcccacaacaatgatgacgccatg
ctcgagtgccgcgtgtgctgcagcctgggcagcttctatgcccaggtcaaggactacgag
aaagccctgttcttcccctgcaaggcggcagagcttgtcaacaactatggcaaaggctgg
agcctgaagtaccgggccatgagccagtaccacatggccgtggcctatcgcctgctgggc
cgcctgggcagtgccatggagtgttgtgaggagtctatgaagatcgcgctgcagcacggg
gaccggccactgcaggcgctctgcctgctctgcttcgctgacatccaccggagccgtggg
gacctggagacagccttccccaggtacgactccgccatgagcatcatgaccgagatcgga
aaccgcctggggcaggtgcaggcgctgctgggtgtggccaagtgctgggtggccaggaag
gcgctggacaaggctctggatgccatcgagagagcccaggatctggccgaggaggtgggg
aacaagctgagccagctcaagctgcactgtctgagcgagagcatttaccgcagcaaaggg
ctgcagcgggaactgcgggcgcacgttgtgaggttccacgagtgcgtggaggagacggag
ctctactgcggcctgtgcggcgagtccataggcgagaagaacagccggctgcaggcccta
ccttgctcccacatcttccacctcaggtgcctgcagaacaacgggacccggagctgtccc
aactgccgccgctcatccatgaagcctggctttgtatga

DBGET integrated database retrieval system