KEGG   Homo sapiens (human): 5915Help
Entry
5915              CDS       T01001                                 

Gene name
RARB, HAP, MCOPS12, NR1B2, RRB2
Definition
retinoic acid receptor, beta
Orthology
K08528  
retinoic acid receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Small cell lung cancer
Non-small cell lung cancer
Disease
H00013  
Small cell lung cancer
H00014  
Non-small cell lung cancer
Drug target
Retinol (vit A): 
Tazarotene: 
Etretinate: 
Acitretin: 
Tretinoin: 
Adapalene: 
Isotretinoin: 
Alitretinoin: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5915 (RARB)
   05222 Small cell lung cancer
    5915 (RARB)
   05223 Non-small cell lung cancer
    5915 (RARB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5915 (RARB)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   5915 (RARB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p24.2
AA seq 448 aa AA seqDB search
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctgtcagtgagtcctgggcaaatcctggatttctacact
gcgagtccgtcttcctgcatgctccaggagaaagctctcaaagcatgcttcagtggattg
acccaaaccgaatggcagcatcggcacactgctcaatcaattgaaacacagagcaccagc
tctgaggaactcgtcccaagccccccatctccacttcctccccctcgagtgtacaaaccc
tgcttcgtctgccaggacaaatcatcagggtaccactatggggtcagcgcctgtgaggga
tgtaagggctttttccgcagaagtattcagaagaatatgatttacacttgtcaccgagat
aagaactgtgttattaataaagtcaccaggaatcgatgccaatactgtcgactccagaag
tgctttgaagtgggaatgtccaaagaatctgtcaggaatgacaggaacaagaaaaagaag
gagacttcgaagcaagaatgcacagagagctatgaaatgacagctgagttggacgatctc
acagagaagatccgaaaagctcaccaggaaactttcccttcactctgccagctgggtaaa
tacaccacgaattccagtgctgaccatcgagtccgactggacctgggcctctgggacaaa
ttcagtgaactggccaccaagtgcattattaagatcgtggagtttgctaaacgtctgcct
ggtttcactggcttgaccatcgcagaccaaattaccctgctgaaggccgcctgcctggac
atcctgattcttagaatttgcaccaggtataccccagaacaagacaccatgactttctca
gacggccttaccctaaatcgaactcagatgcacaatgctggatttggtcctctgactgac
cttgtgttcacctttgccaaccagctcctgcctttggaaatggatgacacagaaacaggc
cttctcagtgccatctgcttaatctgtggagaccgccaggaccttgaggaaccgacaaaa
gtagataagctacaagaaccattgctggaagcactaaaaatttatatcagaaaaagacga
cccagcaagcctcacatgtttccaaagatcttaatgaaaatcacagatctccgtagcatc
agtgctaaaggtgcagagcgtgtaattaccttgaaaatggaaattcctggatcaatgcca
cctctcattcaagaaatgctggagaattctgaaggacatgaacccttgaccccaagttca
agtgggaacacagcagagcacagtcctagcatctcacccagctcagtggaaaacagtggg
gtcagtcagtcaccactcgtgcaataa

DBGET integrated database retrieval system