KEGG   Homo sapiens (human): 5916Help
Entry
5916              CDS       T01001                                 

Gene name
RARG, NR1B3, RARC
Definition
(RefSeq) retinoic acid receptor gamma
  KO
K08529  
retinoic acid receptor gamma
Organism
hsa  Homo sapiens (human)
Drug target
Retinol (vit A): 
Tazarotene: 
Etretinate: 
Acitretin: 
Tretinoin: 
Adapalene: 
Isotretinoin: 
Alitretinoin: 
Other: 
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5916 (RARG)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   5916 (RARG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13
AA seq 454 aa AA seqDB search
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE
MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaataaggagcgactctttgcggctggtgccctggggcctggatctggctac
ccaggggcaggtttccccttcgccttcccaggggcactcagggggtctccgcctttcgag
atgctgagccctagcttccggggcctgggccagcctgacctccccaaggagatggcctct
ctgtcggtggagacacagagcaccagctcagaggagatggtgcccagctcgccctcgccc
cctccgcctcctcgggtctacaagccatgcttcgtgtgcaatgacaagtcctctggctac
cactatggggtcagctcttgtgaaggctgcaagggcttctttcgccgaagcatccagaag
aacatggtgtacacgtgtcaccgcgacaaaaactgtatcatcaacaaggtgaccaggaat
cgctgccagtactgccggctacagaagtgcttcgaagtgggcatgtccaaggaagctgtg
cgaaatgaccggaacaagaagaagaaagaggtgaaggaagaagggtcacctgacagctat
gagctgagccctcagttagaagagctcatcaccaaggtcagcaaagcccatcaggagact
ttcccctcgctctgccagctgggcaagtataccacgaactccagtgcagaccaccgcgtg
cagctggatctggggctgtgggacaagttcagtgagctggctaccaagtgcatcatcaag
atcgtggagtttgccaagcggttgcctggctttacagggctcagcattgctgaccagatc
actctgctcaaagctgcctgcctagatatcctgatgctgcgtatctgcacaaggtacacc
ccagagcaggacaccatgaccttctccgacgggctgaccctgaaccggacccagatgcac
aatgccggcttcgggcccctcacagaccttgtctttgcctttgctgggcagctcctgccc
ctggagatggatgacaccgagacagggctgctcagcgccatctgcctcatctgcggagac
cgcatggacctggaggagcccgaaaaagtggacaagctgcaggagccactgctggaagcc
ctgaggctgtacgcccggcgccggcggcccagccagccctacatgttcccaaggatgcta
atgaaaatcaccgacctccggggcatcagcactaagggagctgaaagggccattactctg
aagatggagattccaggcccgatgcctcccttaatccgagagatgctggagaaccctgaa
atgtttgaggatgactcctcgcagcctggtccccaccccaatgcctctagcgaggatgag
gttcctgggggccagggcaaagggggcctgaagtccccagcctga

DBGET integrated database retrieval system