KEGG   Homo sapiens (human): 5916Help
Entry
5916              CDS       T01001                                 

Gene name
RARG, NR1B3, RARC
Definition
(RefSeq) retinoic acid receptor gamma
  KO
K08529  
retinoic acid receptor gamma
Organism
hsa  Homo sapiens (human)
Drug target
Acitretin: 
Adapalene: 
Alitretinoin: 
Etretinate: 
Fenretinide: 
Isotretinoin (DG00434): 
Palovarotene: 
Retinol (vit A) (DG00123): 
Tamibarotene: 
Tazarotene: 
Tretinoin (DG00433): 
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5916 (RARG)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   5916 (RARG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.13
AA seq 454 aa AA seqDB search
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE
MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaataaggagcgactctttgcggctggtgccctggggcctggatctggctac
ccaggggcaggtttccccttcgccttcccaggggcactcagggggtctccgcctttcgag
atgctgagccctagcttccggggcctgggccagcctgacctccccaaggagatggcctct
ctgtcggtggagacacagagcaccagctcagaggagatggtgcccagctcgccctcgccc
cctccgcctcctcgggtctacaagccatgcttcgtgtgcaatgacaagtcctctggctac
cactatggggtcagctcttgtgaaggctgcaagggcttctttcgccgaagcatccagaag
aacatggtgtacacgtgtcaccgcgacaaaaactgtatcatcaacaaggtgaccaggaat
cgctgccagtactgccggctacagaagtgcttcgaagtgggcatgtccaaggaagctgtg
cgaaatgaccggaacaagaagaagaaagaggtgaaggaagaagggtcacctgacagctat
gagctgagccctcagttagaagagctcatcaccaaggtcagcaaagcccatcaggagact
ttcccctcgctctgccagctgggcaagtataccacgaactccagtgcagaccaccgcgtg
cagctggatctggggctgtgggacaagttcagtgagctggctaccaagtgcatcatcaag
atcgtggagtttgccaagcggttgcctggctttacagggctcagcattgctgaccagatc
actctgctcaaagctgcctgcctagatatcctgatgctgcgtatctgcacaaggtacacc
ccagagcaggacaccatgaccttctccgacgggctgaccctgaaccggacccagatgcac
aatgccggcttcgggcccctcacagaccttgtctttgcctttgctgggcagctcctgccc
ctggagatggatgacaccgagacagggctgctcagcgccatctgcctcatctgcggagac
cgcatggacctggaggagcccgaaaaagtggacaagctgcaggagccactgctggaagcc
ctgaggctgtacgcccggcgccggcggcccagccagccctacatgttcccaaggatgcta
atgaaaatcaccgacctccggggcatcagcactaagggagctgaaagggccattactctg
aagatggagattccaggcccgatgcctcccttaatccgagagatgctggagaaccctgaa
atgtttgaggatgactcctcgcagcctggtccccaccccaatgcctctagcgaggatgag
gttcctgggggccagggcaaagggggcctgaagtccccagcctga

DBGET integrated database retrieval system