KEGG   Homo sapiens (human): 5917Help
Entry
5917              CDS       T01001                                 

Gene name
RARS, ArgRS, DALRD1
Definition
arginyl-tRNA synthetase (EC:6.1.1.19)
Orthology
K01887  
arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:hsa00970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.1
AA seq 660 aa AA seqDB search
MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRK
SLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMG
ISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLV
NGVQLPALGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGD
WGTQFGMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRFDTEEEFKKRAYQCVVLLQGK
NPDITKAWKLICDVSRQELNKIYDALDVSLIERGESFYQDRMNDIVKEFEDRGFVQVDDG
RKIVFVPGCSIPLTIVKSDGGYTYDTSDLAAIKQRLFEEKADMIIYVVDNGQSVHFQTIF
AAAQMIGWYDPKVTRVFHAGFGVVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEK
ERDKVLTAEELNAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTR
IRSIARLANIDEEMLQKAARETKILLDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDY
IYELATAFTEFYDSCYCVEKDRQTGKILKVNMWRMLLCEAVAAVMAKGFDILGIKPVQRM
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggacgtactggtgtctgagtgctccgcgcggctgctgcagcaggaagaagagattaaa
tctctgactgctgaaattgaccggttgaaaaactgtggctgtttaggagcttctccaaat
ttggagcagttacaagaagaaaatttaaaattaaagtatcgactgaatattcttcgaaag
agtcttcaggcagaaaggaacaaaccaactaaaaatatgattaacattattagccgccta
caagaggtctttggtcatgcaattaaggctgcatatccagatttggaaaatcctcctctg
ctagtgacaccaagtcagcaggccaagtttggggactatcagtgtaatagtgctatgggt
atttctcagatgctcaaaaccaaggaacagaaagttaatccaagagaaattgctgaaaac
attaccaaacacctcccagacaatgaatgtattgaaaaagttgaaattgctggtcctggt
tttattaatgtccacttaagaaaggattttgtatcagaacaattgaccagtcttctagtg
aatggagttcaactacctgctctgggagagaataaaaaggttatagttgacttttcctcc
cctaatatagctaaagagatgcatgtaggccacctgaggtcaactatcataggagagagt
ataagccgcctctttgaatttgcagggtatgacgtgctcaggttaaatcatgtaggagac
tgggggacccagtttggcatgctcatcgctcacctgcaagacaaatttccagattatcta
acagtttcacctcctattggggatcttcaggtcttttataaggaatctaagaagaggttt
gatactgaggaggaatttaagaagcgagcatatcagtgtgtagttctgctccagggtaaa
aacccagatattacaaaagcttggaagcttatctgtgatgtctcccgccaagagttaaat
aaaatctatgatgcattggacgtctctttaatagagagaggggaatccttctatcaagat
aggatgaatgatattgtaaaggaatttgaagatagaggatttgtgcaggtggatgatggc
agaaagattgtatttgtcccagggtgttccataccattaaccatagtaaaatcagatgga
ggttatacctatgatacatctgacctggctgctattaaacaaagactatttgaggaaaaa
gcagatatgattatctatgttgtggacaatggacaatctgtgcacttccagacaatattt
gctgctgctcaaatgattggttggtatgaccctaaagtaactcgagtcttccatgctgga
tttggtgtggtgctaggggaagacaagaaaaagtttaaaacacgttcgggtgaaacagtg
cgcctcatggatcttctgggagaaggactaaaacgatccatggacaagttgaaggaaaaa
gaaagagacaaggtcttaactgcagaggaattgaatgctgctcagacatccgttgcgtat
ggctgcatcaaatatgctgacctttcccataaccggttgaatgactacatcttctccttt
gacaaaatgctagatgacagaggaaatacagctgcttacttgttgtatgccttcactaga
atcaggtctattgcacgtctggccaatattgatgaagaaatgctccaaaaagctgctcga
gaaaccaagattcttttggatcatgagaaggaatggaaactaggccggtgcattttacgg
ttccctgagattctgcaaaagattttagatgacttatttctccacactctctgtgattat
atatatgagctggcaactgctttcacagagttctatgatagctgctactgtgtggagaaa
gatagacagactggaaaaatattgaaggtgaacatgtggcgtatgctgctatgtgaagca
gtagctgctgtcatggccaaggggtttgatatcctgggaataaaacctgtccaaaggatg
taa

DBGET integrated database retrieval system