KEGG   Homo sapiens (human): 5919Help
Entry
5919              CDS       T01001                                 

Gene name
RARRES2, HP10433, TIG2
Definition
(RefSeq) retinoic acid receptor responder 2
  KO
K10044  
retinoic acid receptor responder protein 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q36.1
AA seq 163 aa AA seqDB search
MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPF
PAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIE
TQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcgacggctgctgatccctctggccctgtggctgggtgcggtgggcgtgggcgtcgcc
gagctcacggaagcccagcgccggggcctgcaggtggccctggaggaatttcacaagcac
ccgcccgtgcagtgggccttccaggagaccagtgtggagagcgccgtggacacgcccttc
ccagctggaatatttgtgaggctggaatttaagctgcagcagacaagctgccggaagagg
gactggaagaaacccgagtgcaaagtcaggcccaatgggaggaaacggaaatgcctggcc
tgcatcaaactgggctctgaggacaaagttctgggccggttggtccactgccccatagag
acccaagttctgcgggaggctgaggagcaccaggagacccagtgcctcagggtgcagcgg
gctggtgaggacccccacagcttctacttccctggacagttcgccttctccaaggccctg
ccccgcagctaa

DBGET integrated database retrieval system