KEGG   Homo sapiens (human): 5921Help
Entry
5921              CDS       T01001                                 

Gene name
RASA1, CM-AVM, CMAVM, GAP, PKWS, RASA, RASGAP, p120GAP, p120RASGAP
Definition
RAS p21 protein activator (GTPase activating protein) 1
Orthology
K04352  
Ras GTPase-activating protein 1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Axon guidance
Disease
H00532  
RASA1-related disorders
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q13.3
AA seq 1047 aa AA seqDB search
MMAAEAGSEEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPVAAAPYPGLVETGVAGT
LGGGAALGSEFLGAGSVAGALGGAGLTGGGTAAGVAGAAAGVAGAAVAGPSGDMALTKLP
TSLLAETLGPGGGFPPLPPPPYLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQ
WYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYY
IGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEIS
FLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKISKQE
AYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIG
DIIDHYRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGY
LLKKGKGKRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNC
FQIVVQHFSEEHYIFYFAGETPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHI
EEAHKLPVKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVFDDLPPDINRFEITLSN
KTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPE
EEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISM
EDEATTLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNED
VNTNLTHLLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFV
FLRLICPAILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFI
KSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQ
HVLKKLLAITELLQQKQNQYTKTNDVR
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggccgaggccggcagtgaggagggcggcccggtaacagccggagctggagga
ggcggcgcggcagcgggctccagtgcctatcccgcagtgtgtcgggtgaagatacccgcg
gccctgcctgtggcagccgccccctatcctgggctggtggagaccggagtggctggaact
ctgggtggcggagccgctttggggtcagagttcctaggagccgggtctgtggcaggggca
ctggggggagctggactgacagggggaggtactgctgctggcgtagctggtgctgctgct
ggcgtggccggtgctgctgttgctggacctagtggagacatggctctcaccaaactgccc
acttcgttgcttgctgagactctcgggccaggcggcggttttccccctctgccccctccc
ccttacctgccccctttgggggcgggcctcgggacagtggacgaaggtgactctctggat
ggaccagaatacgaggaggaagaggtggccataccgttgaccgctcctccaactaaccag
tggtatcacggaaaacttgacagaacgatagcagaagaacgcctcaggcaggcagggaag
tctggcagttatcttataagagagagtgatcggaggccagggtcctttgtactttcattt
cttagccagatgaatgttgtcaaccattttaggattattgctatgtgtggagattactac
attggtggaagacgtttttcttcactgtcagacctaataggttattacagtcatgtttct
tgtttgcttaaaggagaaaaattactttacccagttgcaccaccagagccagtagaagat
agaaggcgtgtacgagctattctaccttacacaaaagtaccagacactgatgaaataagt
ttcttaaaaggagatatgttcattgttcataatgaattagaagatggatggatgtgggtt
acaaatttaagaacagatgaacaaggccttattgttgaagacctagtagaagaggtgggc
cgggaagaagatccacatgaaggaaaaatatggttccatgggaagatttccaaacaggaa
gcttataatttactaatgacagttggtcaagtctgcagttttcttgtgaggccctcagat
aatactcctggcgattattcactttatttccggaccaatgaaaatattcagcgatttaaa
atatgtccaacgccaaacaatcagtttatgatgggaggccggtattataacagcattggg
gacatcatagatcactatcgaaaagaacagattgttgaaggatattatcttaaggaacct
gtaccaatgcaggatcaagaacaagtactcaatgacacagtggatggcaaggaaatctat
aataccatccgtcgtaaaacaaaggatgccttttataaaaacattgttaagaaaggttat
cttctgaaaaagggcaaaggaaaacgttggaaaaatttatattttatcttagagggtagt
gatgcccaacttatttattttgaaagcgaaaaacgagctaccaaaccaaaaggattaata
gatctcagtgtatgttctgtctatgtcgttcatgatagtctctttggcaggccaaactgt
tttcagatagtagttcagcactttagtgaagaacattacatcttttactttgcaggagaa
actccagaacaagcagaggattggatgaaaggtctgcaggcattttgcaatttacggaaa
agtagtccagggacatccaataaacgccttcgtcaggtcagcagccttgttttacatatt
gaagaagcccataaactcccagtaaaacattttactaatccatattgtaacatctacctg
aatagtgtccaagtagcaaaaactcatgcaagggaagggcaaaacccagtatggtcagaa
gagtttgtctttgatgatcttcctcctgacatcaatagatttgaaataactcttagtaat
aaaacaaagaaaagcaaagatcctgatatcttatttatgcgctgccagttgagccgatta
cagaaagggcatgccacagatgaatggtttctgctcagctcccatataccattaaaaggt
attgaaccagggtccctgcgtgttcgagcacgatactctatggaaaaaatcatgccagaa
gaagagtacagtgaatttaaagagcttatactgcaaaaggaacttcatgtagtctatgct
ttatcacatgtatgtggacaagaccgaacactactggccagcatcctactgaggattttt
cttcacgaaaagcttgaatcgttgttgttatgcacactaaatgacagagaaataagcatg
gaagatgaagccactaccctatttcgagccacaacacttgcaagcaccttgatggagcag
tatatgaaagccactgctacacagtttgttcatcatgctttgaaagactctattttaaag
ataatggaaagcaagcagtcttgtgagttaagtccatcaaagttagaaaaaaatgaagat
gtgaacactaatttaacacacctattgaacatactttcagagcttgtggagaaaatattc
atggcttcagaaatacttccaccgacattgagatatatttatgggtgtttacagaaatct
gttcagcataagtggcctacaaataccaccatgagaacaagagttgttagtggttttgtt
tttcttcgactcatctgtcctgccatcctgaatccacggatgttcaatatcatctcagat
tctccatctcctattgctgcaagaacactgatattagtggctaaatctgtgcagaactta
gcaaatcttgtggaatttggagctaaggagccctacatggaaggtgtcaatccattcatc
aaaagcaacaaacatcgtatgatcatgtttttagatgaacttgggaatgtacctgaactt
ccggacactacagagcattctagaacggacctgtcccgtgatttagcagcattgcatgag
atttgcgtggctcattcagatgaacttcgaacgctcagtaatgagcgtggtgcacagcag
cacgtattgaaaaagcttctggctataacagaactgcttcaacaaaaacaaaaccagtat
acaaaaaccaatgatgtcaggtag

DBGET integrated database retrieval system