KEGG   Homo sapiens (human): 5922Help
Entry
5922              CDS       T01001                                 

Gene name
RASA2, GAP1M
Definition
RAS p21 protein activator 2
Orthology
K08053  
Ras GTPase-activating protein 2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5922 (RASA2)
   04010 MAPK signaling pathway
    5922 (RASA2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    5922 (RASA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
3q22-q23
AA seq 849 aa AA seqDB search
MAAAAPAAAAASSEAPAASATAEPEAGDQDSREVRVLQSLRGKICEAKNLLPYLGPHKMR
DCFCTINLDQEEVYRTQVVEKSLSPFFSEEFYFEIPRTFQYLSFYVYDKNVLQRDLRIGK
VAIKKEDLCNHSGKETWFSLQPVDSNSEVQGKVHLELKLNELITENGTVCQQLVVHIKAC
HGLPLINGQSCDPYATVSLVGPSRNDQKKTKVKKKTSNPQFNEIFYFEVTRSSSYTRKSQ
FQVEEEDIEKLEIRIDLWNNGNLVQDVFLGEIKVPVNVLRTDSSHQAWYLLQPRDNGNKS
SKTDDLGSLRLNICYTEDYVLPSEYYGPLKTLLLKSPDVQPISASAAYILSEICRDKNDA
VLPLVRLLLHHDKLVPFATAVAELDLKDTQDANTIFRGNSLATRCLDEMMKIVGGHYLKV
TLKPILDEICDSSKSCEIDPIKLKEGDNVENNKENLRYYVDKLFNTIVKSSMSCPTVMCD
IFYSLRQMATQRFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHLRPHHPDAQTIRTLTL
ISKTIQTLGSWGSLSKSKSSFKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKESSGT
SEPVHLKEGEMYKRAQGRTRIGKKNFKKRWFCLTSRELTYHKQPGKDAIYTIPVKNILAV
EKLEESSFNKKNMFQVIHTEKPLYVQANNCVEANEWIDVLCRVSRCNQNRLSFYHPSVYL
NGNWLCCQETGENTLGCKPCTAGVPADIQIDIDEDRETERIYSLFTLSLLKLQKMEEACG
TIAVYQGPQKEPDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGSK
ENPIVGKAS
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcgcctgctgctgcggcggcttcttccgaggcgccagcggcgagtgcg
actgcagagcccgaggccggggaccaggacagtcgcgaggttcgagtgttgcagagcctg
cggggcaagatctgtgaagcaaaaaatttattgccatatcttggaccccacaaaatgaga
gattgtttctgtaccataaatttggaccaggaagaagtttatcgtacccaagttgtggaa
aaatctttaagcccatttttcagtgaagaattttactttgagattccaagaactttccag
tatttgtctttctatgtttatgataagaatgttttacaaagagatctccgtataggaaaa
gtagccatcaaaaaagaagacttgtgtaatcacagtggcaaagaaacttggttttcatta
cagcctgttgactccaattcagaggttcagggtaaagttcaccttgaattaaaactgaat
gaactgataacggagaatggaactgtatgccagcagcttgttgtacacatcaaggcatgc
catgggttgcctctcataaatggccaaagctgtgacccttatgcaacagtttctctagtg
ggcccttctaggaatgaccaaaagaagacaaaagtaaagaagaaaacaagcaatccgcag
tttaatgaaatcttttattttgaagtaaccagatccagtagttacaccagaaagtcccag
ttccaggtagaagaggaggacattgaaaagctagaaatcaggatcgacttgtggaacaat
ggaaacctagtccaagatgttttcctaggtgagattaaggttcctgtgaacgtattaaga
actgattcctctcatcaagcctggtacttgctacagccaagagacaatggaaacaagtca
tccaaaactgatgacctggggtctcttcgattaaatatatgttatacagaagactacgtg
cttccttcagagtactatggtcctttgaaaactttgctgctaaaatcaccagatgttcaa
ccaatatctgcctcagctgcttacattttgagtgaaatatgtcgagataaaaatgatgct
gttttgccccttgtacgactgctgctgcaccatgataaacttgttccttttgccactgct
gtggctgaattagacttgaaggatacacaagatgcaaacacaatttttagaggaaattcc
ctggctacccgatgtctggatgagatgatgaaaatagtgggagggcactacctgaaagta
acattaaaacctattcttgatgagatatgtgactcctcaaaatcctgtgaaatcgatcct
attaaattgaaagagggagataatgtagaaaataataaggagaatctgcgctactatgta
gacaagttattcaatacaattgtaaaatcaagtatgagctgccccactgtaatgtgtgat
atcttttattctctaaggcagatggctactcagagatttcctaatgaccctcatgttcag
tattctgcagtgagcagctttgtatttcttcgtttctttgctgtagccgtagtatcacct
catacttttcatttgcgacctcatcatccagatgcacagacaattagaacattaactctc
atctcaaaaactatacaaactttgggaagctgggggagtctgtccaaaagcaagtcaagt
ttcaaagagacattcatgtgtgaatttttcaaaatgtttcaagaagaaggatatattata
gcagttaaaaagttcttggatgaaatttcatctactgaaactaaagagtccagtggtacg
agtgagcctgtgcacctgaaagaaggtgagatgtataaaagagctcaaggaagaactcgg
attggaaaaaagaattttaagaaacgatggttctgcttaacaagcagagagctcacctac
cacaaacagccaggcaaagatgcaatctacacaatcccagtaaaaaacattcttgctgtg
gaaaaactggaagagagctctttcaacaagaaaaatatgttccaagtaatacatacggag
aaaccactctatgtccaggcaaataactgtgtagaagctaatgaatggatagacgtactc
tgcagggtgagccgatgcaatcaaaacaggctcagtttttatcatccctctgtgtatcta
aacggaaattggctctgctgtcaggagactggtgaaaacactctcggctgcaagccatgt
actgcaggtgtccctgcagacatccaaatagatattgatgaagacagagaaacagaaaga
atttattccctttttaccctcagtttacttaagctgcagaagatggaagaggcttgtgga
actattgcagtctatcaaggaccacagaaagagcctgatgattattctaactttgtaatc
gaggattctgtaacaacctttaagacaattcagcaaataaaaagcataattgagaagctg
gatgaacctcatgaaaaatataggaagaaaagatccagtagtgcaaaatatgggagcaag
gaaaatccaattgttgggaaagcatcttag

DBGET integrated database retrieval system