KEGG   Homo sapiens (human): 5923Help
Entry
5923              CDS       T01001                                 

Gene name
RASGRF1, CDC25, CDC25L, GNRP, GRF1, GRF55, H-GRF55, PP13187, ras-GRF1
Definition
(RefSeq) Ras protein specific guanine nucleotide releasing factor 1
  KO
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5923 (RASGRF1)
   04010 MAPK signaling pathway
    5923 (RASGRF1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5923 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13972(Tbio)
UniProt: 
Position
15q25.1
AA seq 1273 aa AA seqDB search
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEITS
LLKDNERIQSTQTVAPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSG
QDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKRTREGTREAEMSRSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERL
TDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKPISAIPARWLRSLELLFASGQNN
KLLYGEPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSN
GYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMRE
ESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSAL
SAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRH
WVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLE
EITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIM
KTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSA
IFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFI
EEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESL
YESSLRIEPKLPT
NT seq 3822 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggggatccggctgaatgatggccacgtcgcgtccctgggactgctggcgcgc
aaggacggcacgcgcaaaggctacctgagcaagcggagttcggacaacacaaaatggcaa
accaagtggttcgcgctgctgcagaacctgctcttctacttcgagagcgactcgagctcg
cggccctcggggctttacctgctggagggctgcgtctgcgaccgcgcgccctcccccaag
ccggcgctgtcggccaaggagccgctggagaaacagcattacttcacggtgaacttcagc
catgagaaccagaaagccttggagctgaggacagaggacgcaaaagattgtgacgaatgg
gtggcagccattgcacatgccagctacaggaccctcgccacagagcatgaggcattaatg
cagaaatacctgcacctgctgcagatcgtggagacagagaagaccgtggccaagcagctt
cggcagcagatcgaggatggggagatcgagatcgagcggctgaaggcagagatcacatcc
ctgctcaaggacaatgagcgcatccagtccacccagactgtcgcccccaacgatgaagac
agcgacatcaagaaaattaagaaggtgcagagcttcctgcggggctggctgtgccggcgg
aagtggaagaccatcatccaggactacatccggtcaccccatgctgacagcatgcgcaag
aggaaccaggtggtgttcagcatgctggaggctgaggctgagtacgtgcagcagctgcac
atccttgtcaacaatttcctgcgcccgctgcggatggccgccagctccaagaagcctccc
atcacacacgacgacgtcagcagcatcttcctgaacagcgaaaccatcatgtttttacat
cagatcttttaccaaggcctgaaggcccgcatctccagctggcccacgctggtcctggct
gacctatttgacatcctgctgcccatgctcaacatctaccaagagttcgtccgcaaccac
cagtacagcctgcagatcctggcccactgcaagcagaaccgtgacttcgacaagctgctg
aagcactacgaggccaagcctgactgcgaggagaggacgctggagaccttcctcacctac
cccatgttccagatccccaggtacatcctgaccctccatgagctcctggcccacacgcct
catgagcacgttgagcgcaacagcctggactacgccaagtccaaactggaggagctgtcc
agaataatgcacgatgaagtaagtgagacggagaacatccggaaaaacctggccatcgag
cgcatgatcatcgaaggctgtgagatcctcctggacaccagccagacctttgtgagacaa
ggttccctcattcaggtgcccatgtctgaaaagggcaagatcaccagggggcgcctgggg
tctctctccctaaagaaagagggcgagcgacagtgcttcctgttttctaagcatctgatt
atctgtaccagaggctctggagggaagcttcacttgaccaagaatggagtcatatccctc
attgactgcactttattggaggagccagaaagcacggaggaggaagccaaaggatccggc
caagacatagatcacttggattttaaaatcggggtggagccaaaggattccccgcccttt
acagtcatcctagtggcctcgtccagacaggagaaggcagcgtggaccagtgacatcagc
cagtgtgtggataacatccgatgcaatgggctcatgatgaacgcatttgaagaaaattcc
aaggtcactgtgccgcagatgatcaagaggaccagggaggggaccagggaagcagaaatg
agcaggtccgacgcctccttatattgtgatgatgttgacattcgcttcagcaaaaccatg
aactcctgcaaagtgctgcagatccgctacgccagtgtggagcggctgctggagaggctg
acggacctgcgcttcctgagcatcgacttcctcaacaccttcctgcactcctaccgcgtc
ttcaccaccgccatcgtggtcctggacaagctcattaccatctacaagaagcctatcagt
gccattcctgccaggtggctgaggtcgctggagctcctgtttgccagtggccagaacaat
aagctcctgtacggtgaaccccccaagtccccgcgcgccacccgcaagttctcctcgccg
ccacctctgtccatcaccaagacatcgtcaccgagccgccggcggaagctctccctgaac
atccccatcatcactggcggcaaggccctggacctggccgccctcagctgcaactccaat
ggctacaccagcatgtactcggccatgtcacccttcagcaaggccacgctggacaccagc
aagctctatgtgtccagcagcttcaccaacaagattccagatgagggcgatacgacccct
gagaagcccgaagacccttcagcgctcagcaagcagagctcagaagtctccatgagagag
gagtcagatattgatcaaaaccagagtgatgatggtgatactgaaacatcaccaactaaa
tctccaacaacacccaaatcagtcaaaaacaaaaattcttcagagttcccactcttttcc
tataacaatggagtcgtcatgacctcctgtcgtgaactggacaataaccgcagtgccttg
tcggccgcctctgcctttgccatagcaaccgccggggccaacgagggcaccccaaacaag
gagaagtaccggaggatgtccttagccagtgcagggtttcccccagaccagaggaatgga
gacaaggagtttgtgatccgcagagcagccaccaatcgtgtcttgaacgtgctccgccac
tgggtgtccaagcactctcaggactttgagaccaacgatgagctcaaatgcaaggtgatc
ggcttcctggaagaagtcatgcacgacccggagctcctgacccaggagcggaaggctgca
gccaacatcatcaggactctgacccaggaggacccaggtgacaaccagatcacgctggag
gagatcacgcagatggctgaaggcgtgaaggctgagccctttgaaaaccactcagccctg
gagatcgcggagcagctgaccctgctagatcacctcgtcttcaagaagattccttatgag
gagttcttcggacaaggatggatgaaactggaaaagaatgaaaggaccccttatatcatg
aaaaccactaagcacttcaatgacatcagtaacttgattgcttcagaaatcatccgcaat
gaggacatcaacgccagggtgagcgccatcgagaagtgggtggccgtagctgacatatgc
cgctgcctccacaactacaatgccgtactggagatcacctcgtccatgaaccgcagtgca
atcttccggctcaaaaagacgtggctcaaagtctctaagcagactaaagctttgattgat
aagctccaaaagcttgtgtcatctgagggcagatttaagaatctcagagaagctctgaaa
aattgtgacccaccctgtgtcccttacctggggatgtacctcaccgacctggccttcatc
gaggaggggacgcccaattacacggaagacggcctggtcaacttctccaagatgaggatg
atatcccatattatccgagagattcgccagtttcaacaaactgcctacaaaatagagcac
caagcaaaggtaacgcaatatttactggaccaatcttttgtaatggatgaagaaagcctc
tacgagtcttctctccgaatagaaccaaaactccccacctga

KEGG   Homo sapiens (human): 5924Help
Entry
5924              CDS       T01001                                 

Gene name
RASGRF2, GRF2, RAS-GRF2
Definition
(RefSeq) Ras protein specific guanine nucleotide releasing factor 2
  KO
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5924 (RASGRF2)
   04010 MAPK signaling pathway
    5924 (RASGRF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O14827(Tbio)
UniProt: 
Position
5q14.1
AA seq 1237 aa AA seqDB search
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSC
RPAGMYLLEGCSCERTPAPPRAGAGQGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDAAAFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQSPAASPPPH
TGQIPLDLSRGLSSPEQSPGTVEENVDNPRVDLCNKLKRSIQKAVLESAPADRAGVESSP
AADTTELSPCRSPSTPRHLRYRQPGGQTADNAHCSVSPASAFAIATAAAGHGSPPGFNNT
ERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQE
RKAAANILRALSQDDQDDIHLKLEDIIQMTDCMKAECFESLSAMELAEQITLLDHVIFRS
IPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWVAV
ADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLR
ETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTSY
RIDHQPKVAQYLLDKDLIIDEDTLYELSLKIEPRLPA
NT seq 3714 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgctacaacgaggggcacgccctgtacctggcctttctggcgcgc
aaggagggcaccaagcgcggcttcctgagtaagaagacggccgaggcgagccgctggcac
gagaagtggttcgccctctaccagaatgtgctcttctacttcgagggcgagcagagctgc
cgcccggcgggcatgtacctcctggagggctgcagctgcgaacgaacgcccgcgccaccc
agggccggcgccgggcagggaggcgtccgagacgcgctggacaagcagtattactttact
gttctttttggccatgaaggtcagaagccactggagctgcgctgtgaggaggagcaggat
ggtaaagagtggatggaggccattcaccaagccagttatgcagacattttgattgagagg
gaagtattaatgcagaagtacattcatctagttcagatcgtagagacagaaaaaattgca
gctaaccaactccgacatcaacttgaagatcaagacacagaaatcgaaaggcttaaatca
gagattattgctcttaataaaaccaaagaacgaatgcgaccttaccaaagcaaccaagaa
gacgaagatccagacatcaagaagattaaaaaggttcagagcttcatgcgaggatggttg
tgcagaaggaaatggaagaccatcgtgcaggattacatttgttctcctcatgctgaaagt
atgaggaagagaaaccagattgtgttcaccatggtggaggcagagtcagagtacgttcac
cagctctacatcctggtcaatggctttctccggcccctgcgtatggccgccagctccaag
aagccccccatcagccacgacgacgtcagcagtatttttcttaacagtgaaacaatcatg
tttcttcatgaaatatttcatcaaggactaaaggcaaggatagcaaactggcccacttta
attttagctgatctgtttgatattttgctccccatgctgaacatttatcaagaatttgtg
cgtaatcaccagtacagcctgcaagttctcgccaattgtaagcaaaacagagattttgac
aaactcttaaaacagtatgaagccaatccagcctgtgaggggaggatgctggagacattc
ttgacctatcccatgtttcagatccccagatatatcatcacactccatgagctccttgct
cacacaccccatgagcatgtggaaaggaaaagcctggagtttgccaaatcaaagctagag
gaactatccagagtaatgcacgatgaagtcagcgacactgaaaacataaggaaaaacctt
gccatcgaaagaatgatcgtggagggctgtgacatcttgctggacaccagccaaacgttc
atccgccaaggttctcttattcaagtaccttccgttgagagggggaaacttagtaaagtt
cgcctgggttcgttgtctttgaaaaaggaaggagagagacaatgcttcttatttacaaaa
cactttttaatatgtacaagaagttcaggagggaagcttcatctgctcaagacaggtggg
gttctgtctctaatagactgcacattgattgaggagccagatgcaagcgatgatgactct
aaaggttctgggcaagtgtttgggcacctggattttaaaatagtggtggagcctcctgac
gctgccgccttcactgttgtcttgttagcaccctcacgccaggagaaagctgcctggatg
agtgacatcagtcagtgtgtggacaatatacgatgtaatggtttaatgactatagtgttt
gaagagaattccaaagtcactgtgccacatatgattaagtctgatgcccgtcttcataaa
gacgacactgacatttgcttcagtaaaacactcaactcctgcaaagtgccccagatccgt
tatgccagcgtggagcgcctcttggaacgactgacagacttgcggtttcttagtattgat
ttcctcaacacctttctgcacacctatcgtattttcactactgccgctgtggtgctgggg
aaactctccgacatatacaagaggcctttcacctccatccctgtcaggtcattggaattg
ttttttgctaccagccagaacaacagaggtgaacatttggtggatggcaaatccccacgt
ctgtgtcgcaaattctcttccccgccaccactggctgtgtccagaacatcttccccagtg
agggccagaaagctgtctttgacttctcccttgaactcaaagataggagcattggacctg
acaacttccagcagtcccaccaccaccacccagagtcccgctgcgtctccaccaccacac
actggtcagataccactggatctcagcagaggcctctcttctccagagcaaagcccggga
acggtagaagagaatgtcgataacccacgcgtggatctgtgtaacaagctaaaacgaagt
attcaaaaagcagtcctagagtctgcaccagcggaccgagcaggagtggaaagctcccct
gcagcggacaccacagaactttcaccttgcagatccccctcaactcctcggcacctccgc
tatcgacagcctggaggacagacggcggacaatgcccactgctctgtttcaccggcttct
gcttttgcaatagccacagctgcagcaggacatgggagtccaccaggctttaacaacacc
gagagaacatgtgataaagagtttattatacggagaacggctaccaatcgagttctgaac
gtcctccgtcactgggtctcaaagcacgcacaggatttcgaactcaacaatgaactaaag
atgaatgtcctaaatttgctagaagaagttttgcgagacccagaccttcttccccaagaa
aggaaagccgccgcgaatatcctcagggccctttcacaagatgaccaagatgacatccac
ctaaaattagaggatataattcaaatgactgactgcatgaaggccgaatgctttgagtcc
ttgtcggccatggagctggcagaacagatcaccctcctggaccatgtcattttcagaagc
attccctacgaggagtttcttgggcaggggtggatgaagctggataaaaacgaaagaact
ccttacattatgaaaaccagccaacacttcaatgacatgagtaacctggtggcctcccag
ataatgaactatgctgatgtcagctcccgtgccaacgccatcgagaaatgggtggcagtg
gcggacatctgccgatgcctgcacaactacaacggcgtgctggagatcacctcggcctta
aacagaagtgccatctacaggctgaagaaaacctgggccaaggtctctaagcagacaaaa
gctctaatggacaaacttcaaaagactgtttcctctgaaggaagatttaaaaatcttaga
gaaacccttaaaaattgtaaccctcctgcagttccttatcttgggatgtacttgacagac
ctggcatttattgaagaaggaacaccaaactttactgaggaaggccttgtcaatttctcc
aaaatgagaatgatatcacacatcatcagagagatacgccagttccagcagacttcctac
agaatagatcatcagccaaaggtcgcacagtacttgcttgacaaagaccttatcatagat
gaagatacgctatatgagctgtcactaaaaattgaacctcgactccctgcttga

DBGET integrated database retrieval system