KEGG   Homo sapiens (human): 5924Help
Entry
5924              CDS       T01001                                 

Gene name
RASGRF2, GRF2, RAS-GRF2
Definition
Ras protein-specific guanine nucleotide-releasing factor 2
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5924 (RASGRF2)
   04010 MAPK signaling pathway
    5924 (RASGRF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q13
AA seq 1237 aa AA seqDB search
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSC
RPAGMYLLEGCSCERTPAPPRAGAGQGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDAAAFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQSPAASPPPH
TGQIPLDLSRGLSSPEQSPGTVEENVDNPRVDLCNKLKRSIQKAVLESAPADRAGVESSP
AADTTELSPCRSPSTPRHLRYRQPGGQTADNAHCSVSPASAFAIATAAAGHGSPPGFNNT
ERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQE
RKAAANILRALSQDDQDDIHLKLEDIIQMTDCMKAECFESLSAMELAEQITLLDHVIFRS
IPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWVAV
ADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLR
ETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTSY
RIDHQPKVAQYLLDKDLIIDEDTLYELSLKIEPRLPA
NT seq 3714 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgctacaacgaggggcacgccctgtacctggcctttctggcgcgc
aaggagggcaccaagcgcggcttcctgagtaagaagacggccgaggcgagccgctggcac
gagaagtggttcgccctctaccagaatgtgctcttctacttcgagggcgagcagagctgc
cgcccggcgggcatgtacctcctggagggctgcagctgcgaacgaacgcccgcgccaccc
agggccggcgccgggcagggaggcgtccgagacgcgctggacaagcagtattactttact
gttctttttggccatgaaggtcagaagccactggagctgcgctgtgaggaggagcaggat
ggtaaagagtggatggaggccattcaccaagccagttatgcagacattttgattgagagg
gaagtattaatgcagaagtacattcatctagttcagatcgtagagacagaaaaaattgca
gctaaccaactccgacatcaacttgaagatcaagacacagaaatcgaaaggcttaaatca
gagattattgctcttaataaaaccaaagaacgaatgcgaccttaccaaagcaaccaagaa
gacgaagatccagacatcaagaagattaaaaaggttcagagcttcatgcgaggatggttg
tgcagaaggaaatggaagaccatcgtgcaggattacatttgttctcctcatgctgaaagt
atgaggaagagaaaccagattgtgttcaccatggtggaggcagagtcagagtacgttcac
cagctctacatcctggtcaatggctttctccggcccctgcgtatggccgccagctccaag
aagccccccatcagccacgacgacgtcagcagtatttttcttaacagtgaaacaatcatg
tttcttcatgaaatatttcatcaaggactaaaggcaaggatagcaaactggcccacttta
attttagctgatctgtttgatattttgctccccatgctgaacatttatcaagaatttgtg
cgtaatcaccagtacagcctgcaagttctcgccaattgtaagcaaaacagagattttgac
aaactcttaaaacagtatgaagccaatccagcctgtgaggggaggatgctggagacattc
ttgacctatcccatgtttcagatccccagatatatcatcacactccatgagctccttgct
cacacaccccatgagcatgtggaaaggaaaagcctggagtttgccaaatcaaagctagag
gaactatccagagtaatgcacgatgaagtcagcgacactgaaaacataaggaaaaacctt
gccatcgaaagaatgatcgtggagggctgtgacatcttgctggacaccagccaaacgttc
atccgccaaggttctcttattcaagtaccttccgttgagagggggaaacttagtaaagtt
cgcctgggttcgttgtctttgaaaaaggaaggagagagacaatgcttcttatttacaaaa
cactttttaatatgtacaagaagttcaggagggaagcttcatctgctcaagacaggtggg
gttctgtctctaatagactgcacattgattgaggagccagatgcaagcgatgatgactct
aaaggttctgggcaagtgtttgggcacctggattttaaaatagtggtggagcctcctgac
gctgccgccttcactgttgtcttgttagcaccctcacgccaggagaaagctgcctggatg
agtgacatcagtcagtgtgtggacaatatacgatgtaatggtttaatgactatagtgttt
gaagagaattccaaagtcactgtgccacatatgattaagtctgatgcccgtcttcataaa
gacgacactgacatttgcttcagtaaaacactcaactcctgcaaagtgccccagatccgt
tatgccagcgtggagcgcctcttggaacgactgacagacttgcggtttcttagtattgat
ttcctcaacacctttctgcacacctatcgtattttcactactgccgctgtggtgctgggg
aaactctccgacatatacaagaggcctttcacctccatccctgtcaggtcattggaattg
ttttttgctaccagccagaacaacagaggtgaacatttggtggatggcaaatccccacgt
ctgtgtcgcaaattctcttccccgccaccactggctgtgtccagaacatcttccccagtg
agggccagaaagctgtctttgacttctcccttgaactcaaagataggagcattggacctg
acaacttccagcagtcccaccaccaccacccagagtcccgctgcgtctccaccaccacac
actggtcagataccactggatctcagcagaggcctctcttctccagagcaaagcccggga
acggtagaagagaatgtcgataacccacgcgtggatctgtgtaacaagctaaaacgaagt
attcaaaaagcagtcctagagtctgcaccagcggaccgagcaggagtggaaagctcccct
gcagcggacaccacagaactttcaccttgcagatccccctcaactcctcggcacctccgc
tatcgacagcctggaggacagacggcggacaatgcccactgctctgtttcaccggcttct
gcttttgcaatagccacagctgcagcaggacatgggagtccaccaggctttaacaacacc
gagagaacatgtgataaagagtttattatacggagaacggctaccaatcgagttctgaac
gtcctccgtcactgggtctcaaagcacgcacaggatttcgaactcaacaatgaactaaag
atgaatgtcctaaatttgctagaagaagttttgcgagacccagaccttcttccccaagaa
aggaaagccgccgcgaatatcctcagggccctttcacaagatgaccaagatgacatccac
ctaaaattagaggatataattcaaatgactgactgcatgaaggccgaatgctttgagtcc
ttgtcggccatggagctggcagaacagatcaccctcctggaccatgtcattttcagaagc
attccctacgaggagtttcttgggcaggggtggatgaagctggataaaaacgaaagaact
ccttacattatgaaaaccagccaacacttcaatgacatgagtaacctggtggcctcccag
ataatgaactatgctgatgtcagctcccgtgccaacgccatcgagaaatgggtggcagtg
gcggacatctgccgatgcctgcacaactacaacggcgtgctggagatcacctcggcctta
aacagaagtgccatctacaggctgaagaaaacctgggccaaggtctctaagcagacaaaa
gctctaatggacaaacttcaaaagactgtttcctctgaaggaagatttaaaaatcttaga
gaaacccttaaaaattgtaaccctcctgcagttccttatcttgggatgtacttgacagac
ctggcatttattgaagaaggaacaccaaactttactgaggaaggccttgtcaatttctcc
aaaatgagaatgatatcacacatcatcagagagatacgccagttccagcagacttcctac
agaatagatcatcagccaaaggtcgcacagtacttgcttgacaaagaccttatcatagat
gaagatacgctatatgagctgtcactaaaaattgaacctcgactccctgcttga

DBGET integrated database retrieval system