KEGG   Homo sapiens (human): 59272Help
Entry
59272             CDS       T01001                                 

Gene name
ACE2, ACEH
Definition
angiotensin I converting enzyme 2 (EC:3.4.17.23)
Orthology
K09708  
angiotensin-converting enzyme 2 [EC:3.4.17.23]
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    59272 (ACE2)
  Digestive system
   04974 Protein digestion and absorption
    59272 (ACE2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.23  angiotensin-converting enzyme 2
     59272 (ACE2)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M2
   59272 (ACE2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   59272 (ACE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22
AA seq 805 aa AA seqDB search
MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTIL
NTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLY
EEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHL
HAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
AWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILM
CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM
KREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLH
KCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNK
NSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKN
QMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDN
SLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENP
YASIDISKGENNPGFQNTDDVQTSF
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcttcctggctccttctcagccttgttgctgtaactgctgctcagtccacc
attgaggaacaggccaagacatttttggacaagtttaaccacgaagccgaagacctgttc
tatcaaagttcacttgcttcttggaattataacaccaatattactgaagagaatgtccaa
aacatgaataatgctggggacaaatggtctgcctttttaaaggaacagtccacacttgcc
caaatgtatccactacaagaaattcagaatctcacagtcaagcttcagctgcaggctctt
cagcaaaatgggtcttcagtgctctcagaagacaagagcaaacggttgaacacaattcta
aatacaatgagcaccatctacagtactggaaaagtttgtaacccagataatccacaagaa
tgcttattacttgaaccaggtttgaatgaaataatggcaaacagtttagactacaatgag
aggctctgggcttgggaaagctggagatctgaggtcggcaagcagctgaggccattatat
gaagagtatgtggtcttgaaaaatgagatggcaagagcaaatcattatgaggactatggg
gattattggagaggagactatgaagtaaatggggtagatggctatgactacagccgcggc
cagttgattgaagatgtggaacatacctttgaagagattaaaccattatatgaacatctt
catgcctatgtgagggcaaagttgatgaatgcctatccttcctatatcagtccaattgga
tgcctccctgctcatttgcttggtgatatgtggggtagattttggacaaatctgtactct
ttgacagttccctttggacagaaaccaaacatagatgttactgatgcaatggtggaccag
gcctgggatgcacagagaatattcaaggaggccgagaagttctttgtatctgttggtctt
cctaatatgactcaaggattctgggaaaattccatgctaacggacccaggaaatgttcag
aaagcagtctgccatcccacagcttgggacctggggaagggcgacttcaggatccttatg
tgcacaaaggtgacaatggacgacttcctgacagctcatcatgagatggggcatatccag
tatgatatggcatatgctgcacaaccttttctgctaagaaatggagctaatgaaggattc
catgaagctgttggggaaatcatgtcactttctgcagccacacctaagcatttaaaatcc
attggtcttctgtcacccgattttcaagaagacaatgaaacagaaataaacttcctgctc
aaacaagcactcacgattgttgggactctgccatttacttacatgttagagaagtggagg
tggatggtctttaaaggggaaattcccaaagaccagtggatgaaaaagtggtgggagatg
aagcgagagatagttggggtggtggaacctgtgccccatgatgaaacatactgtgacccc
gcatctctgttccatgtttctaatgattactcattcattcgatattacacaaggaccctt
taccaattccagtttcaagaagcactttgtcaagcagctaaacatgaaggccctctgcac
aaatgtgacatctcaaactctacagaagctggacagaaactgttcaatatgctgaggctt
ggaaaatcagaaccctggaccctagcattggaaaatgttgtaggagcaaagaacatgaat
gtaaggccactgctcaactactttgagcccttatttacctggctgaaagaccagaacaag
aattcttttgtgggatggagtaccgactggagtccatatgcagaccaaagcatcaaagtg
aggataagcctaaaatcagctcttggagataaagcatatgaatggaacgacaatgaaatg
tacctgttccgatcatctgttgcatatgctatgaggcagtactttttaaaagtaaaaaat
cagatgattctttttggggaggaggatgtgcgagtggctaatttgaaaccaagaatctcc
tttaatttctttgtcactgcacctaaaaatgtgtctgatatcattcctagaactgaagtt
gaaaaggccatcaggatgtcccggagccgtatcaatgatgctttccgtctgaatgacaac
agcctagagtttctggggatacagccaacacttggacctcctaaccagccccctgtttcc
atatggctgattgtttttggagttgtgatgggagtgatagtggttggcattgtcatcctg
atcttcactgggatcagagatcggaagaagaaaaataaagcaagaagtggagaaaatcct
tatgcctccatcgatattagcaaaggagaaaataatccaggattccaaaacactgatgat
gttcagacctccttttag

DBGET integrated database retrieval system