KEGG   Homo sapiens (human): 59272Help
Entry
59272             CDS       T01001                                 

Gene name
ACE2, ACEH
Definition
angiotensin I converting enzyme 2 (EC:3.4.17.23)
Orthology
K09708  
angiotensin-converting enzyme 2 [EC:3.4.17.23]
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
Protein digestion and absorption
Class
Organismal Systems; Endocrine system; Renin-angiotensin system [PATH:hsa04614]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22
AA seq 805 aa AA seqDB search
MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTIL
NTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLY
EEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHL
HAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
AWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILM
CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM
KREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLH
KCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNK
NSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKN
QMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDN
SLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENP
YASIDISKGENNPGFQNTDDVQTSF
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcttcctggctccttctcagccttgttgctgtaactgctgctcagtccacc
attgaggaacaggccaagacatttttggacaagtttaaccacgaagccgaagacctgttc
tatcaaagttcacttgcttcttggaattataacaccaatattactgaagagaatgtccaa
aacatgaataatgctggggacaaatggtctgcctttttaaaggaacagtccacacttgcc
caaatgtatccactacaagaaattcagaatctcacagtcaagcttcagctgcaggctctt
cagcaaaatgggtcttcagtgctctcagaagacaagagcaaacggttgaacacaattcta
aatacaatgagcaccatctacagtactggaaaagtttgtaacccagataatccacaagaa
tgcttattacttgaaccaggtttgaatgaaataatggcaaacagtttagactacaatgag
aggctctgggcttgggaaagctggagatctgaggtcggcaagcagctgaggccattatat
gaagagtatgtggtcttgaaaaatgagatggcaagagcaaatcattatgaggactatggg
gattattggagaggagactatgaagtaaatggggtagatggctatgactacagccgcggc
cagttgattgaagatgtggaacatacctttgaagagattaaaccattatatgaacatctt
catgcctatgtgagggcaaagttgatgaatgcctatccttcctatatcagtccaattgga
tgcctccctgctcatttgcttggtgatatgtggggtagattttggacaaatctgtactct
ttgacagttccctttggacagaaaccaaacatagatgttactgatgcaatggtggaccag
gcctgggatgcacagagaatattcaaggaggccgagaagttctttgtatctgttggtctt
cctaatatgactcaaggattctgggaaaattccatgctaacggacccaggaaatgttcag
aaagcagtctgccatcccacagcttgggacctggggaagggcgacttcaggatccttatg
tgcacaaaggtgacaatggacgacttcctgacagctcatcatgagatggggcatatccag
tatgatatggcatatgctgcacaaccttttctgctaagaaatggagctaatgaaggattc
catgaagctgttggggaaatcatgtcactttctgcagccacacctaagcatttaaaatcc
attggtcttctgtcacccgattttcaagaagacaatgaaacagaaataaacttcctgctc
aaacaagcactcacgattgttgggactctgccatttacttacatgttagagaagtggagg
tggatggtctttaaaggggaaattcccaaagaccagtggatgaaaaagtggtgggagatg
aagcgagagatagttggggtggtggaacctgtgccccatgatgaaacatactgtgacccc
gcatctctgttccatgtttctaatgattactcattcattcgatattacacaaggaccctt
taccaattccagtttcaagaagcactttgtcaagcagctaaacatgaaggccctctgcac
aaatgtgacatctcaaactctacagaagctggacagaaactgttcaatatgctgaggctt
ggaaaatcagaaccctggaccctagcattggaaaatgttgtaggagcaaagaacatgaat
gtaaggccactgctcaactactttgagcccttatttacctggctgaaagaccagaacaag
aattcttttgtgggatggagtaccgactggagtccatatgcagaccaaagcatcaaagtg
aggataagcctaaaatcagctcttggagataaagcatatgaatggaacgacaatgaaatg
tacctgttccgatcatctgttgcatatgctatgaggcagtactttttaaaagtaaaaaat
cagatgattctttttggggaggaggatgtgcgagtggctaatttgaaaccaagaatctcc
tttaatttctttgtcactgcacctaaaaatgtgtctgatatcattcctagaactgaagtt
gaaaaggccatcaggatgtcccggagccgtatcaatgatgctttccgtctgaatgacaac
agcctagagtttctggggatacagccaacacttggacctcctaaccagccccctgtttcc
atatggctgattgtttttggagttgtgatgggagtgatagtggttggcattgtcatcctg
atcttcactgggatcagagatcggaagaagaaaaataaagcaagaagtggagaaaatcct
tatgcctccatcgatattagcaaaggagaaaataatccaggattccaaaacactgatgat
gttcagacctccttttag

DBGET integrated database retrieval system