KEGG   Homo sapiens (human): 59277Help
Entry
59277             CDS       T01001                                 

Gene name
NTN4, PRO3091
Definition
netrin 4
Orthology
K06845  
netrin 4
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    59277 (NTN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q22
AA seq 628 aa AA seqDB search
MGSCARLLLLWGCTVVAAGLSGVAGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATEL
YCFYSENTDLTCRQPKCDKCNAAYPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLD
LEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKYFATNCSATFGLEDDVVKKGAI
CTSKYSSPFPCTGGEVIFKALSPPYDTENPYSAKVQEQLKITNLRVQLLKRQSCPCQRND
LNEEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPVKAPGTFHMVHGKCMCKHNTA
GSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCD
DCQHNTEGQYCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDC
PCKPGVAGRRCDRCMVGYWGFGDYGCRPCDCAGSCDPITGDCISSHTDIDWYHEVPDFRP
VHNKSEPAWEWEDAQGFSALLHSGKCECKEQTLGNAKAFCGMKYSYVLKIKILSAHDKGT
HVEVNVKIKKVLKSTKLKIFRGKRTLYPESWTDRGCTCPILNPGLEYLVAGHEDIRTGKL
IVNMKSFVQHWKPSLGRKVMDILKRECK
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggggagctgcgcgcggctgctgctgctctggggctgcacggtggtggccgcaggactg
agtggagtagctggagtgagttcccgctgtgaaaaagcctgcaaccctcggatgggaaat
ttggctttggggcgaaaactctgggcagacaccacctgcggtcagaatgctaccgaactg
tactgcttctacagtgagaacacggatctgacttgtcggcagcccaaatgtgacaagtgc
aatgctgcctatcctcacctggctcacctgccatctgccatggcagactcatccttccgg
tttcctcgcacatggtggcagtctgcggaggatgtgcacagagaaaagatccagttagac
ctggaagctgaattctacttcactcacctaattgtgatgttcaagtcccccaggccggct
gccatggtgctggaccgctcccaggactttgggaaaacatggaagccttataagtacttt
gcgactaactgctccgctacatttggcctggaagatgatgttgtcaagaagggcgctatt
tgtacttctaaatactccagtccttttccatgcactggaggagaggttattttcaaagct
ttgtcaccaccatacgatacagagaacccttacagtgccaaagttcaggagcagctgaag
atcaccaaccttcgcgtgcagctgctgaaacgacagtcttgtccctgtcagagaaatgac
ctgaacgaagagcctcaacattttacacactatgcaatctatgatttcattgtcaagggc
agctgcttctgcaatggccacgctgatcaatgcatacctgttcatggcttcagacctgtc
aaggccccaggaacattccacatggtccatgggaagtgtatgtgtaagcacaacacagca
ggcagccactgccagcactgtgccccgttatacaatgaccggccatgggaggcagctgat
ggcaaaacgggggctcccaacgagtgcagaacctgcaagtgtaatgggcatgctgatacc
tgtcacttcgacgttaatgtgtgggaggcatcagggaatcgtagtggtggtgtctgtgat
gactgtcagcacaacacagaaggacagtattgccagaggtgcaagccaggcttctatcgt
gacctgcggagacccttctcagctccagatgcttgcaaaccgtgttcctgccatccagta
ggatcagctgtccttcctgccaactcagtgaccttctgcgaccccagcaatggtgactgc
ccttgcaagcctggggtggcagggcgacgttgtgacaggtgcatggtgggatactggggc
ttcggagactatggctgtcgaccatgtgactgtgcggggagctgtgaccctatcaccgga
gactgcatcagcagccacacagacatagactggtatcatgaagttcctgacttccgtccc
gtgcacaataagagcgaaccagcctgggagtgggaggatgcgcaggggttttctgcactt
ctacactcaggtaaatgcgaatgtaaggaacagacattaggaaatgccaaggcattctgt
ggaatgaaatattcatatgtgctaaaaataaagattttatcagctcatgataaaggtact
catgttgaggtcaatgtgaagattaaaaaggtcttaaaatctaccaaactgaagattttc
cgaggaaagcgaacattatatccagaatcatggacggacagaggatgcacttgtccaatc
ctcaatcctggtttggaataccttgtagcaggacatgaggatataagaacaggcaaacta
attgtgaatatgaaaagctttgtccagcactggaaaccttctcttggaagaaaagtcatg
gatattttaaaaagagagtgcaagtag

DBGET integrated database retrieval system