KEGG   Homo sapiens (human): 5928Help
Entry
5928              CDS       T01001                                 

Gene name
RBBP4, NURF55, RBAP48, lin-53
Definition
(RefSeq) RB binding protein 4, chromatin remodeling factor
  KO
K10752  
histone-binding protein RBBP4
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    CAF-1
     5928 (RBBP4)
  Histone modification proteins
   HAT complexes
    HATB complex
     5928 (RBBP4)
   HDAC complexes
    Sin3A-HDAC complex
     5928 (RBBP4)
   Polycomb group proteins
    PRC2-EZH1 complex
     5928 (RBBP4)
    PRC2-EZH2 complex
     5928 (RBBP4)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    MIS16-MIS18 complex
     5928 (RBBP4)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    5928 (RBBP4)
  Chromatin remodeling factors
   NuRD complex
    5928 (RBBP4)
   NuRF complex
    5928 (RBBP4)
   NuRF complex (fruit fly)
    5928 (RBBP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p35.1
AA seq 425 aa AA seqDB search
MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKD
FSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK
INHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEG
YGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHE
SLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVAL
WDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAE
DGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP
EGQGS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaaggaagcagccttcgacgacgcagtggaagaacgagtgatcaacgaggaa
tacaaaatatggaaaaagaacaccccttttctttatgatttggtgatgacccatgctctg
gagtggcccagcctaactgcccagtggcttccagatgtaaccagaccagaagggaaagat
ttcagcattcatcgacttgtcctggggacacacacatcggatgaacaaaaccatcttgtt
atagccagtgtgcagctccctaatgatgatgctcagtttgatgcgtcacactacgacagt
gagaaaggagaatttggaggttttggttcagttagtggaaaaattgaaatagaaatcaag
atcaaccatgaaggagaagtaaacagggcccgttatatgccccagaacccttgtatcatc
gcaacaaagactccttccagtgatgttcttgtttttgactatacaaaacatccttctaaa
ccagatccttctggagagtgcaacccagacttgcgtctccgtggacatcagaaggaaggc
tatgggctttcttggaacccaaatctcagtgggcacttacttagtgcttcagatgaccat
accatctgcctgtgggacatcagtgccgttccaaaggagggaaaagtggtagatgcgaag
accatctttacagggcatacggcagtagtagaagatgtttcctggcatctactccatgag
tctctgtttgggtcagttgctgatgatcagaaacttatgatttgggatactcgttcaaac
aatacttccaaaccaagccactcagttgatgctcacactgctgaagtgaactgcctttct
ttcaatccttatagtgagttcattcttgccacaggatcagctgacaagactgttgccttg
tgggatctgagaaatctgaaacttaagttgcattcctttgagtcacataaggatgaaata
ttccaggttcagtggtcacctcacaatgagactattttagcttccagtggtactgatcgc
agactgaatgtctgggatttaagtaaaattggagaggaacaatccccagaagatgcagaa
gacgggccaccagagttgttgtttattcatggtggtcatactgccaagatatctgatttc
tcctggaatcccaatgaaccttgggtgatttgttctgtatcagaagacaatatcatgcaa
gtgtggcaaatggcagagaacatttataatgatgaagaccctgaaggaagcgtggatcca
gaaggacaagggtcctag

DBGET integrated database retrieval system