KEGG   Homo sapiens (human): 59283Help
Entry
59283             CDS       T01001                                 

Gene name
CACNG8
Definition
calcium channel, voltage-dependent, gamma subunit 8
Orthology
K04873  
voltage-dependent calcium channel gamma-8
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    59283 (CACNG8)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    59283 (CACNG8)
  Circulatory system
   04260 Cardiac muscle contraction
    59283 (CACNG8)
   04261 Adrenergic signaling in cardiomyocytes
    59283 (CACNG8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    59283 (CACNG8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    59283 (CACNG8)
   05414 Dilated cardiomyopathy (DCM)
    59283 (CACNG8)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN gamma
   59283 (CACNG8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.4
AA seq 425 aa AA seqDB search
MESLKRWNEERGLWCEKGVQVLLTTVGAFAAFGLMTIAISTDYWLYTRALICNTTNLTAG
GDDGTPHRGGGGASEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEY
LLRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVY
ISANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIERSREAHCQSRS
DLLKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRSSEPSPSRDASPGGPGGPGFA
STDISMYTLSRDPSKGSVAAGLAGAGGGGGGAVGAFGGAAGGAGGGGGGGGGAGAERDRG
GASGFLTLHNAFPKEAGGGVTVTVTGPPAPPAPAPPAPSAPAPGTLAKEAAASNTNTLNR
KTTPV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
ctggagtcgctgaagcgctggaacgaagagcggggcctctggtgcgagaagggggtgcag
gtgctgctgacgacggtgggcgccttcgccgccttcggcctcatgaccatcgccatcagc
actgactactggctctacacgcgcgccctcatctgcaacaccaccaacctcacggccggc
ggcgacgacgggaccccccaccgcgggggcggcggcgcctcggagaagaaggaccccggc
ggcctcacgcactcgggcctctggaggatctgctgcctggaagggttgaaaagaggcgtc
tgcgtgaagatcaatcatttcccggaggacacggactacgaccacgacagcgcggagtat
ctactccgagttgtccgggcctccagcatcttccccatccttagcgccatcctgctgctg
ctcgggggtgtgtgcgtggcggcctcccgcgtctacaagtccaagaggaacatcattctg
ggcgcagggatcctgttcgtggcagcaggcctgagcaacatcatcggcgtgatcgtgtac
atctccgccaacgcgggcgagccgggcccgaagcgggacgaggagaagaaaaaccactac
tcgtacggctggtccttctacttcggcgggctgtcgttcatcctggccgaggtgataggc
gtgctggccgtcaacatctacatcgagcgcagccgcgaggcgcactgccagtctcgctcg
gacctgctcaaggccggcgggggcgcgggcggcagtggcgggagcggcccctcggccatc
ctccgtctgcccagttaccgcttccgctaccgccgccgctcccgctctagctcccgctcc
agcgagccgtcgccgtcgcgggacgcgtctcccggcggccccgggggcccgggctttgcc
tccacggacatctccatgtacacgctcagccgcgacccctccaagggcagcgtggccgcg
gggctggcgggggccggcggcggcggcggcggcgccgtgggggcgttcggcggcgcggcc
gggggcgccgggggcggcggcggaggcggcggcggggcgggtgccgagcgggaccgcggg
ggggcgtccggcttcctcacgctgcacaacgccttccccaaggaggcgggcggcggcgtc
acggtcacggtcaccgggccgcccgccccgcccgcgcccgcgccacccgcgccctctgcg
cccgcccccgggaccctggccaaggaggccgccgcctccaacaccaacacgctcaacagg
aaaaccacgcctgtgtag

DBGET integrated database retrieval system