KEGG   Homo sapiens (human): 59285Help
Entry
59285             CDS       T01001                                 

Gene name
CACNG6
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 6
  KO
K04871  voltage-dependent calcium channel gamma-6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04921  Oxytocin signaling pathway
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    59285 (CACNG6)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    59285 (CACNG6)
  Circulatory system
   04260 Cardiac muscle contraction
    59285 (CACNG6)
   04261 Adrenergic signaling in cardiomyocytes
    59285 (CACNG6)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    59285 (CACNG6)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    59285 (CACNG6)
   05414 Dilated cardiomyopathy (DCM)
    59285 (CACNG6)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN gamma
   59285 (CACNG6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF1700 DUF1686 Phage_holin_3_6
Motif
Other DBs
NCBI-GeneID: 59285
NCBI-ProteinID: NP_665813
OMIM: 606898
HGNC: 13625
Ensembl: ENSG00000130433
Vega: OTTHUMG00000064907
Pharos: Q9BXT2(Tdark)
UniProt: Q9BXT2
Position
19q13.42
AA seq 260 aa AA seqDB search
MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTE
FWVELNTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFF
TTGENARIFQRTTKKEVNLAAAVIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGAVCFGL
SGLLLLVSLEVFRHSVRALLQRVSPEPPPAPRLTYEYSWSLGCGVGAGLILLLGAGCFLL
LTLPSWPWGSLCPKRGHRAT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggtccaacttcttcctgcaagaggagaaccggcggcggggggccgcgggccgg
cggcgggcgcacgggcagggcaggtcggggctgacgcccgagcgcgaggggaaggtgaag
ctggcgctgctgctggccgccgtgggcgccacgctggcggtgctgtccgtgggcaccgag
ttctgggtggagctcaacacctacaaggccaacggcagcgccgtgtgcgaagcggcccac
ctggggctgtggaaggcgtgcaccaagcggctgtggcaggcggacgtgcccgtggacagg
gacacctgcggccccgcggagctgcccggagaagcaaactgcacctattttaaattcttc
accacgggggagaatgcacgcatctttcagagaaccacaaagaaagaggtgaatctggca
gctgcggtgatagcagtgctgggcctggcagtcatggccttggggtgcctctgtatcatc
atggtgctcagtaaaggtgcagagttcctgctccgagttggagccgtctgctttggcctc
tcaggcctgctgctcttggtgagcctggaggtgttccggcattccgtgagggccctgctg
cagagagtcagcccggagcctcccccggccccacgcctcacctacgagtactcctggtcc
ctgggctgcggcgtgggggccggcctgatcctgctgttgggggccggctgctttctgctg
ctcacactgccttcctggccctgggggtccctctgtcccaagcgggggcaccgggccacc
tag

DBGET integrated database retrieval system