KEGG   Homo sapiens (human): 5933Help
Entry
5933              CDS       T01001                                 

Gene name
RBL1, CP107, PRB1, p107
Definition
(RefSeq) RB transcriptional corepressor like 1
  KO
K04681  
retinoblastoma-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Cellular senescence
TGF-beta signaling pathway
Human papillomavirus infection
Viral carcinogenesis
Module
Cell cycle - G1/S transition
Network
N00194  
HPV E7 to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    5933 (RBL1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    5933 (RBL1)
   04218 Cellular senescence
    5933 (RBL1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    5933 (RBL1)
  Infectious diseases
   05165 Human papillomavirus infection
    5933 (RBL1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain Rb
    5933 (RBL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P28749(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.23
AA seq 1068 aa AA seqDB search
MFEDKPHAEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVTHWLA
CSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRE
RIERLERNFEVSTVIFKKYEPIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTL
FVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRQDLLNPSFKGLPSDFHTADFT
ASEEPPCIIAVLCELHDGLLVEAKGIKEHYFKPYISKLFDRKILKGECLLDLSSFTDNSK
AVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTRDTPLGKLTAQANVEYNLQQHFE
KKRSFAPSTPLTGRRYLREKEAVITPVASATQSVSRLQSIVAGLKNAPSDQLINIFESCV
RNPVENIMKILKGIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQET
RRLHGMDMSVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVV
IRSEEGLSRDMVKHLNSIEEQILESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETG
NGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHERYSSPTAGSAKRRL
FGEDPPKEMLMDKIITEGTKLKIAPSSSITAENVSILPGQTLLTMATAPVTGTTGHKVTI
PLHGVANDAGEITLIPLSMNTNQESKVKSPVSLTAHSLIGASPKQTNLTKAQEVHSTGIN
RPKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHL
DQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIPREVVAYNKNIND
DFEMIDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDA
PPLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSGLTPRSALLYKFNGSPSKSLKDINNM
IRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaggacaagccccacgctgagggggcggcggtggtcgccgcagccggggaggcg
ctacaggccctgtgccaggagctgaacctggacgaggggagcgcggccgaagccctggac
gactttactgccatccgaggcaactacagcctagagggagaagttacacactggttggca
tgttcattatatgttgcatgccgcaaaagcattattcccacggttggaaagggtatcatg
gaaggcaactgtgtttcacttaccagaatactacgttcagctaaattaagtttaatacaa
ttttttagtaaaatgaagaaatggatggacatgtcaaatctaccacaagaatttcgtgaa
cgtatagaaaggctagagagaaattttgaggtgtctactgtaatattcaaaaaatatgag
ccaatttttttagatatatttcaaaatccatatgaagaaccaccaaagttaccacgaagc
cggaagcagaggaggattccttgcagtgttaaggatctgtttaatttctgttggacactt
tttgtttatactaagggtaattttcggatgattggggatgacttagtaaactcttatcat
ttacttctatgctgcttggatctgatttttgccaatgcgattatgtgcccaaatagacaa
gacttgctaaatccatcatttaaaggtttaccatctgattttcatactgctgactttacg
gcttctgaagagccaccctgcatcattgctgtactgtgtgaactgcatgatggacttctc
gtagaagcaaaaggaataaaggagcactactttaagccatatatttcaaaactctttgac
aggaagatattaaaaggagaatgcctcctggacctttcaagttttactgataatagcaaa
gcagtgaataaggagtatgaagagtatgttctaactgttggtgattttgatgagaggatc
tttttgggagcagacgcagaagaggaaattggaacacctcgaaagttcactcgtgacacc
ccattagggaaactgacagcacaggctaatgtggagtataaccttcaacagcactttgaa
aaaaaaaggtcatttgcaccttctaccccactgaccggacggagatatttacgagaaaaa
gaagcagtcattactcctgttgcatcagccacccaaagtgtgagccggttacagagtatt
gtggctggtctgaaaaatgcaccaagtgaccaacttataaatatttttgaatcttgtgtg
cgtaatcctgtggaaaacattatgaaaatactaaaaggaataggagagactttctgtcaa
cactatactcaatcaacagatgaacagccaggatctcacatagactttgctgtaaacaga
ctaaagctggcagaaattttgtattataaaatactagagactgtaatggttcaggaaaca
cgaagacttcatggaatggacatgtcagttcttttagagcaagatatatttcatcgttcc
ttgatggcttgttgtttggaaattgtgctctttgcctatagctcacctcgtacttttcct
tggattattgaagttctcaacttgcaaccattttacttttataaggttattgaggtggtg
atccgctcagaagaggggctctcaagggacatggtgaaacacctaaacagcattgaagaa
cagattttggagagtttagcatggagtcacgattctgcactgtgggaggctctccaggtt
tctgcaaacaaagttcctacctgtgaagaagttatattcccaaataactttgaaacagga
aatggaggaaatgtgcagggacatcttcccctgatgccaatgtctcctctaatgcaccca
agagtcaaggaagttcgaactgacagtgggagtcttcgaagagatatgcaaccattgtct
ccaatttctgtccatgaacgctacagttctcctaccgcagggagtgctaagagaagactc
tttggagaggaccccccaaaggaaatgcttatggacaagatcataacagaaggaacaaaa
ttgaaaatcgctccttcttcaagcattactgctgaaaatgtatcaattttacctggtcaa
actcttctaacaatggccacagccccagtaacaggaacaacaggacataaagttacaatt
ccattacatggtgtcgcaaatgatgctggagagatcacactgatacctctttccatgaat
acaaatcaggagtccaaagtcaagagtcctgtatcacttactgctcattcattaattggt
gcttctccaaaacagaccaatctgactaaagcacaagaggtacattcaactggaataaac
aggccaaagagaactgggtccttagcactattttacagaaaggtctatcatttggcaagt
gtacgcttacgtgatctatgtctaaaactggatgtttcaaatgagttacgaaggaagata
tggacgtgttttgaattcactttagttcactgtcctgatctaatgaaagacaggcatttg
gatcagctcctcctttgtgccttttatatcatggcaaaggtaacaaaagaagaaagaact
tttcaagaaattatgaaaagttataggaatcagccccaagctaatagtcacgtatataga
agtgttctgctgaaaagtattccaagagaagttgtggcatataataaaaatataaatgat
gactttgaaatgatagattgtgacttagaagatgctacaaaaacacctgactgttccagt
ggaccagtgaaagaggaaagaggtgatcttataaaattttacaatacaatatatgtagga
agagtgaagtcatttgcactgaaatacgacttggcgaatcaggaccatatgatggatgct
ccaccactctctccttttccacatattaaacaacagccaggctcaccacgccgcatttcc
cagcagcactccatttatatttccccgcacaagaatgggtcaggccttacaccaagaagc
gctctgctgtacaagttcaatggcagcccttctaagagtttgaaagatatcaacaacatg
ataaggcaaggtgagcagagaaccaagaagcgagtaatagccatcgatagtgatgcagaa
tcccctgccaaacgcgtctgtcaagaaaatgatgacgttttactgaaacgactacaggat
gttgtcagtgaaagagcaaatcattaa

DBGET integrated database retrieval system