KEGG   Homo sapiens (human): 5933Help
Entry
5933              CDS       T01001                                 

Gene name
RBL1, CP107, PRB1, p107
Definition
retinoblastoma-like 1
Orthology
K04681  
retinoblastoma-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
TGF-beta signaling pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    5933 (RBL1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    5933 (RBL1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    5933 (RBL1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain Rb
    5933 (RBL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q11.2
AA seq 1068 aa AA seqDB search
MFEDKPHAEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVTHWLA
CSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRE
RIERLERNFEVSTVIFKKYEPIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTL
FVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRQDLLNPSFKGLPSDFHTADFT
ASEEPPCIIAVLCELHDGLLVEAKGIKEHYFKPYISKLFDRKILKGECLLDLSSFTDNSK
AVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTRDTPLGKLTAQANVEYNLQQHFE
KKRSFAPSTPLTGRRYLREKEAVITPVASATQSVSRLQSIVAGLKNAPSDQLINIFESCV
RNPVENIMKILKGIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQET
RRLHGMDMSVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVV
IRSEEGLSRDMVKHLNSIEEQILESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETG
NGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHERYSSPTAGSAKRRL
FGEDPPKEMLMDKIITEGTKLKIAPSSSITAENVSILPGQTLLTMATAPVTGTTGHKVTI
PLHGVANDAGEITLIPLSMNTNQESKVKSPVSLTAHSLIGASPKQTNLTKAQEVHSTGIN
RPKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHL
DQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIPREVVAYNKNIND
DFEMIDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDA
PPLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSGLTPRSALLYKFNGSPSKSLKDINNM
IRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaggacaagccccacgctgagggggcggcggtggtcgccgcagccggggaggcg
ctacaggccctgtgccaggagctgaacctggacgaggggagcgcggccgaagccctggac
gactttactgccatccgaggcaactacagcctagagggagaagttacacactggttggca
tgttcattatatgttgcatgccgcaaaagcattattcccacggttggaaagggtatcatg
gaaggcaactgtgtttcacttaccagaatactacgttcagctaaattaagtttaatacaa
ttttttagtaaaatgaagaaatggatggacatgtcaaatctaccacaagaatttcgtgaa
cgtatagaaaggctagagagaaattttgaggtgtctactgtaatattcaaaaaatatgag
ccaatttttttagatatatttcaaaatccatatgaagaaccaccaaagttaccacgaagc
cggaagcagaggaggattccttgcagtgttaaggatctgtttaatttctgttggacactt
tttgtttatactaagggtaattttcggatgattggggatgacttagtaaactcttatcat
ttacttctatgctgcttggatctgatttttgccaatgcgattatgtgcccaaatagacaa
gacttgctaaatccatcatttaaaggtttaccatctgattttcatactgctgactttacg
gcttctgaagagccaccctgcatcattgctgtactgtgtgaactgcatgatggacttctc
gtagaagcaaaaggaataaaggagcactactttaagccatatatttcaaaactctttgac
aggaagatattaaaaggagaatgcctcctggacctttcaagttttactgataatagcaaa
gcagtgaataaggagtatgaagagtatgttctaactgttggtgattttgatgagaggatc
tttttgggagcagacgcagaagaggaaattggaacacctcgaaagttcactcgtgacacc
ccattagggaaactgacagcacaggctaatgtggagtataaccttcaacagcactttgaa
aaaaaaaggtcatttgcaccttctaccccactgaccggacggagatatttacgagaaaaa
gaagcagtcattactcctgttgcatcagccacccaaagtgtgagccggttacagagtatt
gtggctggtctgaaaaatgcaccaagtgaccaacttataaatatttttgaatcttgtgtg
cgtaatcctgtggaaaacattatgaaaatactaaaaggaataggagagactttctgtcaa
cactatactcaatcaacagatgaacagccaggatctcacatagactttgctgtaaacaga
ctaaagctggcagaaattttgtattataaaatactagagactgtaatggttcaggaaaca
cgaagacttcatggaatggacatgtcagttcttttagagcaagatatatttcatcgttcc
ttgatggcttgttgtttggaaattgtgctctttgcctatagctcacctcgtacttttcct
tggattattgaagttctcaacttgcaaccattttacttttataaggttattgaggtggtg
atccgctcagaagaggggctctcaagggacatggtgaaacacctaaacagcattgaagaa
cagattttggagagtttagcatggagtcacgattctgcactgtgggaggctctccaggtt
tctgcaaacaaagttcctacctgtgaagaagttatattcccaaataactttgaaacagga
aatggaggaaatgtgcagggacatcttcccctgatgccaatgtctcctctaatgcaccca
agagtcaaggaagttcgaactgacagtgggagtcttcgaagagatatgcaaccattgtct
ccaatttctgtccatgaacgctacagttctcctaccgcagggagtgctaagagaagactc
tttggagaggaccccccaaaggaaatgcttatggacaagatcataacagaaggaacaaaa
ttgaaaatcgctccttcttcaagcattactgctgaaaatgtatcaattttacctggtcaa
actcttctaacaatggccacagccccagtaacaggaacaacaggacataaagttacaatt
ccattacatggtgtcgcaaatgatgctggagagatcacactgatacctctttccatgaat
acaaatcaggagtccaaagtcaagagtcctgtatcacttactgctcattcattaattggt
gcttctccaaaacagaccaatctgactaaagcacaagaggtacattcaactggaataaac
aggccaaagagaactgggtccttagcactattttacagaaaggtctatcatttggcaagt
gtacgcttacgtgatctatgtctaaaactggatgtttcaaatgagttacgaaggaagata
tggacgtgttttgaattcactttagttcactgtcctgatctaatgaaagacaggcatttg
gatcagctcctcctttgtgccttttatatcatggcaaaggtaacaaaagaagaaagaact
tttcaagaaattatgaaaagttataggaatcagccccaagctaatagtcacgtatataga
agtgttctgctgaaaagtattccaagagaagttgtggcatataataaaaatataaatgat
gactttgaaatgatagattgtgacttagaagatgctacaaaaacacctgactgttccagt
ggaccagtgaaagaggaaagaggtgatcttataaaattttacaatacaatatatgtagga
agagtgaagtcatttgcactgaaatacgacttggcgaatcaggaccatatgatggatgct
ccaccactctctccttttccacatattaaacaacagccaggctcaccacgccgcatttcc
cagcagcactccatttatatttccccgcacaagaatgggtcaggccttacaccaagaagc
gctctgctgtacaagttcaatggcagcccttctaagagtttgaaagatatcaacaacatg
ataaggcaaggtgagcagagaaccaagaagcgagtaatagccatcgatagtgatgcagaa
tcccctgccaaacgcgtctgtcaagaaaatgatgacgttttactgaaacgactacaggat
gttgtcagtgaaagagcaaatcattaa

DBGET integrated database retrieval system