KEGG   Homo sapiens (human): 59343Help
Entry
59343             CDS       T01001                                 

Gene name
SENP2, AXAM2, SMT3IP2
Definition
SUMO1/sentrin/SMT3 specific peptidase 2 (EC:3.4.22.68)
Orthology
K03345  
sentrin-specific protease 2 (axin associating molecule) [EC:3.4.22.68]
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Wnt signaling pathway
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    59343 (SENP2)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    59343 (SENP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.68  Ulp1 peptidase
     59343 (SENP2)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C48: Ulp1 endopeptidase family
   59343 (SENP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q27.2
AA seq 589 aa AA seqDB search
MYRWLVRILGTIFRFCDRSVPPARALLKRRRSDSTLFSTVDTDEIPAKRPRLDCFIHQVK
NSLYNAASLFGFPFQLTTKPMVTSACNGTRNVAPSGEVFSNSSSCELTGSGSWNNMLKLG
NKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKP
QEQAVTEMISEESGKGLRRPHCTVEEGVQKEEREKYRKLLERLKESGHGNSVCPVTSNYH
SSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSEKRCSKGKITDTE
TMVGIRFENESRRGYQLEPDLSEEVSARLRLGSGSNGLLRRKVSIIETKEKNCSGKERDR
RTDDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYM
NLLVERNKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWS
LVVIDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIP
QQLNGSDCGMFTCKYADYISRDKPITFTQHQMPLFRKKMVWEILHQQLL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgtacagatggctggttaggattctcggcaccattttccgtttctgcgaccggtcggtg
ccccctgcccgggccctcctgaagaggcggcgctcagacagcactctgttttctacagtg
gacactgatgaaataccagccaaaagaccaagattagattgctttattcaccaagtgaaa
aacagtctctacaatgctgccagcttatttggattcccattccagctgaccacaaagccc
atggtaacttctgcttgtaatggaacacggaatgtggccccttcaggagaggtattttcg
aactcttcatcttgtgaactgacaggttctggatcctggaacaacatgctgaaactgggt
aataaatctcctaatggaataagtgactatccaaagatcagagtgacagttacccgagat
cagccacgcagagtcctgccttcctttggttttactttgaactcagaaggctgtaataga
agaccaggtggccgtcgccatagcaaaggtaatccagagagttctttaatgtggaaacct
caggaacaggctgtaacagagatgatttctgaagagagtggcaagggtctgaggcgtccc
cattgtactgtggaggagggtgttcaaaaagaggaaagagagaagtaccgaaagttattg
gaacgacttaaagaaagtggtcatggaaactctgtctgtcctgtaacttcaaattatcac
agttctcaaagaagtcagatggacacattaaagaccaaaggctggggggaagagcaaaat
cacggagtcaaaacaactcagtttgttccaaaacaatatagacttgttgaaacaagggga
cctctatgttcattgagaagtgaaaagaggtgttcaaaggggaaaattactgatacagag
acgatggtcggaatcagatttgaaaatgaaagtaggaggggataccaactggagcctgac
ctatcagaagaagtgtcggcccgactccgcctgggcagtggaagcaatggcttactcagg
aggaaagtgtcaataattgagacaaaggaaaagaattgctcaggcaaagagagggacaga
agaacggacgatctccttgaacttacagaggacatggaaaaggaaatcagtaatgcccta
ggccatggcccacaggatgaaatcctaagtagtgctttcaaattgcgaattactcgagga
gatattcagacattaaagaactatcactggctcaatgatgaagtcattaatttttacatg
aatcttctggtggaaagaaataaaaagcaaggctatccagcacttcatgtattcagtact
ttcttctatcctaaattaaagtctgggggttaccaagcagtgaaacgatggaccaaaggg
gtaaatctctttgaacaagaaattattctggtgcctattcatcggaaggtacattggagc
ctggtggtgattgacctaagaaaaaagtgtcttaaatatctggattctatgggacaaaag
ggccacaggatctgtgagattctccttcagtatttacaggatgaaagtaagaccaaaaga
aatagtgatctgaatcttttagagtggacccatcacagcatgaaaccacacgagattcct
caacagctgaatgggagtgattgtggaatgtttacttgtaaatatgcagattatatttct
agggacaaacctatcacatttactcagcaccagatgcctctcttccggaagaagatggtg
tgggaaatccttcatcagcagttgctgtga

DBGET integrated database retrieval system