KEGG   Homo sapiens (human): 59353Help
Entry
59353             CDS       T01001                                 

Gene name
TMEM35A, TMEM35
Definition
(RefSeq) transmembrane protein 35A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q53FP2(Tdark)
UniProt: 
Position
Xq22.1
AA seq 167 aa AA seqDB search
MASPRTVTIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGIN
SILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALV
FGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcatcccccagaaccgtaactattgtggccctctcagtggccctgggactcttcttt
gttttcatggggactatcaagctgacccccaggctcagcaaggatgcctacagtgagatg
aaacgtgcttacaagagctatgttcgagccctccctctgctgaagaaaatggggatcaat
tccattctcctccgaaaaagcattggtgcccttgaagtggcctgtggcatcgtcatgacc
cttgtgcctgggcgtcccaaagatgtggccaacttcttcctactgttgctggtgttggct
gtgctcttcttccaccagctggtcggtgatcctctcaaacgctacgcccatgctctggtg
tttggaatcctgctcacttgccgcctgctgattgctcgcaagcccgaagaccggtcttct
gagaagaagcctttgccagggaatgctgaggagcaaccctccttatatgagaaggcccct
cagggcaaagtgaaggtgtcatag

DBGET integrated database retrieval system