KEGG   Homo sapiens (human): 5948Help
Entry
5948              CDS       T01001                                 

Gene name
RBP2, CRABP-II, CRBP2, CRBPII, RBPC2
Definition
retinol binding protein 2, cellular
Orthology
K14622  
retinol binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    5948 (RBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q23
AA seq 134 aa AA seqDB search
MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRN
YDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLEL
TCGDQVCRQVFKKK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgacaagggaccagaatggaacctgggagatggagagtaatgaaaactttgagggctac
atgaaggccctggatattgattttgccacccgcaagattgcagtacgtctcactcagacg
aaggttattgatcaagatggtgataacttcaagacaaaaaccactagcacattccgcaac
tatgatgtggatttcactgttggagtagagtttgacgagtacacaaagagcctggataac
cggcatgttaaggcactggtcacctgggaaggtgatgtccttgtgtgtgtgcaaaagggg
gagaaggagaaccgcggctggaagcagtggattgagggggacaagctgtacctggagctg
acctgtggtgaccaggtgtgccgtcaagtgttcaaaaagaaatga

DBGET integrated database retrieval system