KEGG   Homo sapiens (human): 594855Help
Entry
594855            CDS       T01001                                 

Gene name
CPLX3, CPX-III, CPXIII
Definition
complexin 3
Orthology
K15295  
complexin-3/4
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    594855 (CPLX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
15q24.1
AA seq 158 aa AA seqDB search
MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDA
QFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKA
SVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEKCHVM
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcatggtgaagaccatggtgggcggccagctgaagaacctcactgggagcctg
ggaggcggcgaggataagggagatggggacaagtcggcagccgaagctcagggcatgagc
cgggaggagtacgaggagtatcagaagcaactcgtggaagagaagatggagcgggatgca
cagttcacacagaggaaggcagagcgggccacactgcggagccacttccgagacaaatac
cggctacccaagaacgagacagatgagagccagatccagatggcaggtggagacgtggag
ctgccccgggagctggccaagatgatcgaggaggacacagaggaggaggaggagaaggcc
tcagtccttgggcagctggccagccttcctggcttgaacctgggctcactcaaggacaag
gcccaggccacactgggggatctcaagcaatcagctgagaagtgtcacgtcatgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system