KEGG   Homo sapiens (human): 594857Help
Entry
594857            CDS       T01001                                 

Gene name
NPS
Definition
(RefSeq) neuropeptide S
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
10q26.2
AA seq 89 aa AA seqDB search
MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKP
ILEKMFVKRSFRNGVGTGMKKTSFQRAKS
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgattagctcagtaaaactcaatctcatcctagttctgtcgctgtccacaatgcatgtg
ttttggtgttatccagttccatcttctaaggtgtctggaaaatctgattactttctcatt
ctgctgaacagctgcccaaccagattggacaggagcaaagaactagcttttctaaagcca
attttggagaagatgtttgtgaaaaggtcctttcgcaatggagttggcacagggatgaaa
aaaacttcctttcaaagagcaaaatcatga

DBGET integrated database retrieval system