KEGG   Homo sapiens (human): 594857Help
Entry
594857            CDS       T01001                                 

Gene name
NPS
Definition
(RefSeq) neuropeptide S
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Neuropeptide_S
Motif
Other DBs
NCBI-GeneID: 594857
NCBI-ProteinID: NP_001025184
OMIM: 609513
HGNC: 33940
Ensembl: ENSG00000214285
Vega: OTTHUMG00000188145
Pharos: P0C0P6(Tbio)
UniProt: P0C0P6
Position
10q26.2
AA seq 89 aa AA seqDB search
MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKP
ILEKMFVKRSFRNGVGTGMKKTSFQRAKS
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgattagctcagtaaaactcaatctcatcctagttctgtcgctgtccacaatgcatgtg
ttttggtgttatccagttccatcttctaaggtgtctggaaaatctgattactttctcatt
ctgctgaacagctgcccaaccagattggacaggagcaaagaactagcttttctaaagcca
attttggagaagatgtttgtgaaaaggtcctttcgcaatggagttggcacagggatgaaa
aaaacttcctttcaaagagcaaaatcatga

DBGET integrated database retrieval system