KEGG   Homo sapiens (human): 5955Help
Entry
5955              CDS       T01001                                 

Gene name
RCN2, E6BP, ERC-55, ERC55, TCBP49
Definition
reticulocalbin 2, EF-hand calcium binding domain
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Position
15q23
AA seq 335 aa AA seqDB search
MRLGPRTAALGLLLLCAAAAGAGKAEELHYPLGERRSDYDREALLGVQEDVDEYVKLGHE
EQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNSDDTVTWD
EYNIQMYDRVIDFDENTALDDAEEESFRKEFAICKKQSFCFWLLRFNLHLKDKKRFEKAN
QDSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLGDYRWDPTAN
EDPEWILVEKDRFVNDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKK
LSEEEILENPDLFLTSEATDYGRQLHDDYFYHDEL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgggcccgaggaccgcggcgttggggctgctgctgctgtgcgccgccgcggcc
ggcgccggcaaggccgaggagctgcactacccgctgggcgagcgccgcagcgactacgac
cgcgaggcgctgctgggcgtccaggaagatgtggatgaatatgttaaactcggccacgaa
gagcagcaaaaaagactgcaggcgatcataaagaaaatcgacttggactcagatggcttt
ctcactgaaagtgaactcagttcatggattcagatgtcttttaagcattatgctatgcaa
gaagcaaaacaacagtttgttgaatatgataaaaacagtgatgatactgtgacttgggat
gaatataacattcagatgtatgatcgtgtgattgactttgatgagaacactgctctggat
gatgcagaagaggagtcctttaggaaggaatttgccatttgtaaaaaacagtctttctgt
ttttggcttcttcgatttaatcttcacttaaaggacaagaagcgatttgaaaaagctaac
caggattcaggtcccggtttgagtcttgaagaatttattgcttttgagcatcctgaagaa
gttgattatatgacggaatttgtcattcaagaagctttagaagaacatgacaaaaatggt
gatggatttgttagtttggaagaatttcttggtgattacaggtgggatccaactgcaaat
gaagatccagaatggatacttgttgagaaagacagattcgtgaatgattatgacaaagat
aacgatggcaggcttgatccccaagagctgttaccttgggtagtacctaataatcagggc
attgcacaagaggaggcgcttcatctaattgatgaaatggatttgaatggtgacaaaaag
ctctctgaagaagagattctggaaaacccggacttgtttctcaccagtgaagccacagat
tatggcagacagctccatgatgactatttctatcatgatgagctttaa

DBGET integrated database retrieval system