KEGG   Homo sapiens (human): 5956Help
Entry
5956              CDS       T01001                                 

Gene name
OPN1LW, CBBM, CBP, COD5, RCP, ROP
Definition
(RefSeq) opsin 1, long wave sensitive
  KO
K04251  long/medium wavelength-sensitive opsin
Organism
hsa  Homo sapiens (human)
Disease
H00974  Blue cone monochromacy
H00976  Colorblindness
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Vision
   Opsin [OT]
    5956 (OPN1LW)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srw Cytochrom_B_N_2 7TM_GPCR_Sru 7TM_GPCR_Srv 7TM_GPCR_Srt
Motif
Other DBs
NCBI-GeneID: 5956
NCBI-ProteinID: NP_064445
OMIM: 300822
HGNC: 9936
Ensembl: ENSG00000102076
Vega: OTTHUMG00000034295
Position
Xq28
AA seq 364 aa AA seqDB search
MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWM
IFVVTASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISIVNQVSGYFV
LGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWA
AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCIIPLAIIMLCYL
QVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMIFAYCVCWGPYTFFACFAAANPGYAFH
PLMAALPAYFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSS
VSPA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcagtggagcctccaaaggctcgcaggccgccatccgcaggacagctatgag
gacagcacccagtccagcatcttcacctacaccaacagcaactccaccagaggccccttc
gaaggcccgaattaccacatcgctcccagatgggtgtaccacctcaccagtgtctggatg
atctttgtggtcactgcatccgtcttcacaaatgggcttgtgctggcggccaccatgaag
ttcaagaagctgcgccacccgctgaactggatcctggtgaacctggcggtcgctgaccta
gcagagaccgtcatcgccagcactatcagcattgtgaaccaggtctctggctacttcgtg
ctgggccaccctatgtgtgtcctggagggctacaccgtctccctgtgtgggatcacaggt
ctctggtctctggccatcatttcctgggagagatggatggtggtctgcaagccctttggc
aatgtgagatttgatgccaagctggccatcgtgggcattgccttctcctggatctgggct
gctgtgtggacagccccgcccatctttggttggagcaggtactggccccacggcctgaag
acttcatgcggcccagacgtgttcagcggcagctcgtaccccggggtgcagtcttacatg
attgtcctcatggtcacctgctgcatcatcccactcgctatcatcatgctctgctacctc
caagtgtggctggccatccgagcggtggcaaagcagcagaaagagtctgaatccacccag
aaggcagagaaggaagtgacgcgcatggtggtggtgatgatctttgcgtactgcgtctgc
tggggaccctacaccttcttcgcatgctttgctgctgccaaccctggttacgccttccac
cctttgatggctgccctgccggcctactttgccaaaagtgccactatctacaaccccgtt
atctatgtctttatgaaccggcagtttcgaaactgcatcttgcagcttttcgggaagaag
gttgacgatggctctgaactctccagcgcctccaaaacggaggtctcatctgtgtcctcg
gtatcgcctgcatga

DBGET integrated database retrieval system