KEGG   Homo sapiens (human): 5956Help
Entry
5956              CDS       T01001                                 

Gene name
OPN1LW, CBBM, CBP, COD5, RCP, ROP
Definition
opsin 1 (cone pigments), long-wave-sensitive
Orthology
K04251  
long/medium wavelength-sensitive opsin
Organism
hsa  Homo sapiens (human)
Disease
H00974  
Blue cone monochromacy
H00976  
Colorblindness
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Position
Xq28
AA seq 364 aa AA seqDB search
MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWM
IFVVTASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISIVNQVSGYFV
LGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWA
AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCIIPLAIIMLCYL
QVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMIFAYCVCWGPYTFFACFAAANPGYAFH
PLMAALPAYFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSS
VSPA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcagtggagcctccaaaggctcgcaggccgccatccgcaggacagctatgag
gacagcacccagtccagcatcttcacctacaccaacagcaactccaccagaggccccttc
gaaggcccgaattaccacatcgctcccagatgggtgtaccacctcaccagtgtctggatg
atctttgtggtcactgcatccgtcttcacaaatgggcttgtgctggcggccaccatgaag
ttcaagaagctgcgccacccgctgaactggatcctggtgaacctggcggtcgctgaccta
gcagagaccgtcatcgccagcactatcagcattgtgaaccaggtctctggctacttcgtg
ctgggccaccctatgtgtgtcctggagggctacaccgtctccctgtgtgggatcacaggt
ctctggtctctggccatcatttcctgggagagatggatggtggtctgcaagccctttggc
aatgtgagatttgatgccaagctggccatcgtgggcattgccttctcctggatctgggct
gctgtgtggacagccccgcccatctttggttggagcaggtactggccccacggcctgaag
acttcatgcggcccagacgtgttcagcggcagctcgtaccccggggtgcagtcttacatg
attgtcctcatggtcacctgctgcatcatcccactcgctatcatcatgctctgctacctc
caagtgtggctggccatccgagcggtggcaaagcagcagaaagagtctgaatccacccag
aaggcagagaaggaagtgacgcgcatggtggtggtgatgatctttgcgtactgcgtctgc
tggggaccctacaccttcttcgcatgctttgctgctgccaaccctggttacgccttccac
cctttgatggctgccctgccggcctactttgccaaaagtgccactatctacaaccccgtt
atctatgtctttatgaaccggcagtttcgaaactgcatcttgcagcttttcgggaagaag
gttgacgatggctctgaactctccagcgcctccaaaacggaggtctcatctgtgtcctcg
gtatcgcctgcatga

DBGET integrated database retrieval system