KEGG   Homo sapiens (human): 5959Help
Entry
5959              CDS       T01001                                 

Gene name
RDH5, 9cRDH, HSD17B9, RDH1, SDR9C5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
Disease
H00825  Familial flecked retina syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    5959 (RDH5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     5959 (RDH5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Motif
Other DBs
NCBI-GeneID: 5959
NCBI-ProteinID: NP_001186700
OMIM: 601617
HGNC: 9940
Ensembl: ENSG00000135437
Vega: OTTHUMG00000170126
Pharos: Q92781(Tbio)
UniProt: Q92781 A0A024RB18
Position
12q13.2
AA seq 318 aa AA seqDB search
MWLPLLLGALLWAVLWLLRDRQSLPASNAFVFITGCDSGFGRLLALQLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDITDPQSVQQAAKWVEMHVKEAGLFGLVNNAGVAGIIGP
TPWLTRDDFQRVLNVNTMGPIGVTLALLPLLQQARGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNLESLEKTLQACWARLPPATQAHYGGA
FLTKYLKMQQRIMNLICDPDLTKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQAVY
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcctcttctgctgggtgccttactctgggcagtgctgtggttgctcagggac
cggcagagcctgcccgccagcaatgcctttgtcttcatcaccggctgtgactcaggcttt
gggcgccttctggcactgcagctggaccagagaggcttccgagtcctggccagctgcctg
accccctccggggccgaggacctgcagcgggtggcctcctcccgcctccacaccaccctg
ttggatatcactgatccccagagcgtccagcaggcagccaagtgggtggagatgcacgtt
aaggaagcagggctttttggtctggtgaataatgctggtgtggctggtatcatcggaccc
acaccatggctgacccgggacgatttccagcgggtgctgaatgtgaacacaatgggtccc
atcggggtcacccttgccctgctgcctctgctgcagcaagcccggggccgggtgatcaac
atcaccagcgtcctgggtcgcctggcagccaatggtgggggctactgtgtctccaaattt
ggcctggaggccttctctgacagcctgaggcgggatgtagctcattttgggatacgagtc
tccatcgtggagcctggcttcttccgaacccctgtgaccaacctggagagtctggagaaa
accctgcaggcctgctgggcacggctgcctcctgccacacaggcccactatgggggggcc
ttcctcaccaagtacctgaaaatgcaacagcgcatcatgaacctgatctgtgacccggac
ctaaccaaggtgagccgatgcctggagcatgccctgactgctcgacacccccgaacccgc
tacagcccaggttgggatgccaagctgctctggctgcctgcctcctacctgccagccagc
ctggtggatgctgtgctcacctgggtccttcccaagcctgcccaagcagtctactga

DBGET integrated database retrieval system