KEGG   Homo sapiens (human): 5959Help
Entry
5959              CDS       T01001                                 

Gene name
RDH5, 9cRDH, HSD17B9, RDH1, SDR9C5
Definition
retinol dehydrogenase 5 (11-cis/9-cis) (EC:1.1.1.315)
Orthology
K00061  
11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Disease
H00825  
Familial flecked retina syndrome
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:hsa00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13-q14
AA seq 318 aa AA seqDB search
MWLPLLLGALLWAVLWLLRDRQSLPASNAFVFITGCDSGFGRLLALQLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDITDPQSVQQAAKWVEMHVKEAGLFGLVNNAGVAGIIGP
TPWLTRDDFQRVLNVNTMGPIGVTLALLPLLQQARGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNLESLEKTLQACWARLPPATQAHYGGA
FLTKYLKMQQRIMNLICDPDLTKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQAVY
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcctcttctgctgggtgccttactctgggcagtgctgtggttgctcagggac
cggcagagcctgcccgccagcaatgcctttgtcttcatcaccggctgtgactcaggcttt
gggcgccttctggcactgcagctggaccagagaggcttccgagtcctggccagctgcctg
accccctccggggccgaggacctgcagcgggtggcctcctcccgcctccacaccaccctg
ttggatatcactgatccccagagcgtccagcaggcagccaagtgggtggagatgcacgtt
aaggaagcagggctttttggtctggtgaataatgctggtgtggctggtatcatcggaccc
acaccatggctgacccgggacgatttccagcgggtgctgaatgtgaacacaatgggtccc
atcggggtcacccttgccctgctgcctctgctgcagcaagcccggggccgggtgatcaac
atcaccagcgtcctgggtcgcctggcagccaatggtgggggctactgtgtctccaaattt
ggcctggaggccttctctgacagcctgaggcgggatgtagctcattttgggatacgagtc
tccatcgtggagcctggcttcttccgaacccctgtgaccaacctggagagtctggagaaa
accctgcaggcctgctgggcacggctgcctcctgccacacaggcccactatgggggggcc
ttcctcaccaagtacctgaaaatgcaacagcgcatcatgaacctgatctgtgacccggac
ctaaccaaggtgagccgatgcctggagcatgccctgactgctcgacacccccgaacccgc
tacagcccaggttgggatgccaagctgctctggctgcctgcctcctacctgccagccagc
ctggtggatgctgtgctcacctgggtccttcccaagcctgcccaagcagtctactga

DBGET integrated database retrieval system