KEGG   Homo sapiens (human): 5962Help
Entry
5962              CDS       T01001                                 

Gene name
RDX, DFNB24
Definition
radixin
Orthology
K05762  
radixin
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Proteoglycans in cancer
MicroRNAs in cancer
Disease
H00605  
Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    5962 (RDX)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    5962 (RDX)
   05205 Proteoglycans in cancer
    5962 (RDX)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   5962 (RDX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q23
AA seq 604 aa AA seqDB search
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLKQIEEQTIK
AQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIP
PTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARD
ETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAMWGPKLYALFQMRSCQSS
IKQM
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaccaatcaacgtaagagtaactacaatggatgctgagctggaatttgccatt
cagcccaatacaactggcaaacaactttttgaccaggtggtgaaaacagttggtttgcgt
gaggtctggttttttgggctgcagtatgtagacagcaaaggttattctacatggcttaaa
ctaaataaaaaggtaacacagcaggatgttaaaaaagagaatcctttacagttcaagttt
agagctaaattctttcctgaagatgtttctgaggaattaattcaagaaataacccagaga
ctcttcttcttgcaagttaaagaagccatcttaaatgatgagatatattgcccgccagaa
actgcagttcttttggcttcctatgctgtccaagccaagtatggagattacaataaagag
attcataagccaggctacctggctaatgatagactcctaccccagcgtgtattggaacaa
cacaaactaacaaaagaacagtgggaagaaagaatacagaactggcatgaagaacataga
ggaatgttaagggaggattctatgatggaatacctgaagattgcacaagatctagaaatg
tatggagtcaactattttgaaataaaaaataaaaaaggaactgaattgtggctaggtgtt
gatgctttgggtctgaatatttatgagcatgacgacaagttaacacctaaaattggtttt
ccctggagtgaaatcagaaatatttcatttaatgacaaaaaatttgttataaagccaatc
gacaaaaaggcacctgattttgtgttttatgcacctcgtctgagaatcaataagcggatt
ttggccttatgtatgggaaaccatgaactatacatgcgaagaaggaagcctgatactatt
gaagtacaacagatgaaggctcaggctagggaggagaaacatcagaagcagttggaaagg
gcacaattagagaatgaaaagaagaaaagagaaatagcagaaaaggaaaaggaaagaata
gaacgtgaaaaggaagagctaatggaacgtctaaaacaaattgaagagcagacaattaaa
gctcagaaagaactagaagaacagactcgaaaagctctagaactggatcaagaacgaaaa
cgagcaaaagaagaagcagaacgacttgaaaaggagcgtcgagctgctgaagaggcaaag
tctgccatagcaaaacaagctgccgaccagatgaagaatcaggagcagctagcagcagaa
cttgctgaattcactgccaagattgcacttctagaggaagccaagaagaaaaaggaagag
gaagctactgagtggcaacacaaagcttttgcagcccaggaagacttggaaaagaccaaa
gaagagttaaaaactgtgatgtctgccccccctccacctccaccaccaccagtcattcct
ccaacagaaaacgaacatgatgaacacgatgagaataatgctgaagctagtgctgaatta
tcaaatgaaggggtaatgaaccatagaagcgaggaagaacgtgtaaccgaaacacagaaa
aatgagcgtgttaagaagcaacttcaggcattaagttcagaattagcccaagccagagat
gaaaccaagaaaacacaaaatgatgttcttcatgctgagaatgttaaagcaggccgtgat
aagtacaagactctgcgacagattcgacaaggcaatacaaagcagcgtatcgatgagttt
gaagcaatgtggggacccaaactgtatgcattgttccagatgcgctcttgccaaagcagc
ataaagcaaatgtaa

DBGET integrated database retrieval system