KEGG   Homo sapiens (human): 5962Help
Entry
5962              CDS       T01001                                 

Gene name
RDX, DFNB24
Definition
(RefSeq) radixin
  KO
K05762  radixin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04810  Regulation of actin cytoskeleton
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    5962 (RDX)
  Cell motility
   04810 Regulation of actin cytoskeleton
    5962 (RDX)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    5962 (RDX)
   05205 Proteoglycans in cancer
    5962 (RDX)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   5962 (RDX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERM FERM_M FERM_C FERM_N
Motif
Other DBs
NCBI-GeneID: 5962
NCBI-ProteinID: NP_002897
OMIM: 179410
HGNC: 9944
Ensembl: ENSG00000137710
Vega: OTTHUMG00000166574
Pharos: P35241(Tbio)
UniProt: P35241 B0YJ88 Q6PKD3
Position
11q22.3
AA seq 583 aa AA seqDB search
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLKQIEEQTIK
AQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIP
PTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARD
ETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaccaatcaacgtaagagtaactacaatggatgctgagctggaatttgccatt
cagcccaatacaactggcaaacaactttttgaccaggtggtgaaaacagttggtttgcgt
gaggtctggttttttgggctgcagtatgtagacagcaaaggttattctacatggcttaaa
ctaaataaaaaggtaacacagcaggatgttaaaaaagagaatcctttacagttcaagttt
agagctaaattctttcctgaagatgtttctgaggaattaattcaagaaataacccagaga
ctcttcttcttgcaagttaaagaagccatcttaaatgatgagatatattgcccgccagaa
actgcagttcttttggcttcctatgctgtccaagccaagtatggagattacaataaagag
attcataagccaggctacctggctaatgatagactcctaccccagcgtgtattggaacaa
cacaaactaacaaaagaacagtgggaagaaagaatacagaactggcatgaagaacataga
ggaatgttaagggaggattctatgatggaatacctgaagattgcacaagatctagaaatg
tatggagtcaactattttgaaataaaaaataaaaaaggaactgaattgtggctaggtgtt
gatgctttgggtctgaatatttatgagcatgacgacaagttaacacctaaaattggtttt
ccctggagtgaaatcagaaatatttcatttaatgacaaaaaatttgttataaagccaatc
gacaaaaaggcacctgattttgtgttttatgcacctcgtctgagaatcaataagcggatt
ttggccttatgtatgggaaaccatgaactatacatgcgaagaaggaagcctgatactatt
gaagtacaacagatgaaggctcaggctagggaggagaaacatcagaagcagttggaaagg
gcacaattagagaatgaaaagaagaaaagagaaatagcagaaaaggaaaaggaaagaata
gaacgtgaaaaggaagagctaatggaacgtctaaaacaaattgaagagcagacaattaaa
gctcagaaagaactagaagaacagactcgaaaagctctagaactggatcaagaacgaaaa
cgagcaaaagaagaagcagaacgacttgaaaaggagcgtcgagctgctgaagaggcaaag
tctgccatagcaaaacaagctgccgaccagatgaagaatcaggagcagctagcagcagaa
cttgctgaattcactgccaagattgcacttctagaggaagccaagaagaaaaaggaagag
gaagctactgagtggcaacacaaagcttttgcagcccaggaagacttggaaaagaccaaa
gaagagttaaaaactgtgatgtctgccccccctccacctccaccaccaccagtcattcct
ccaacagaaaacgaacatgatgaacacgatgagaataatgctgaagctagtgctgaatta
tcaaatgaaggggtaatgaaccatagaagcgaggaagaacgtgtaaccgaaacacagaaa
aatgagcgtgttaagaagcaacttcaggcattaagttcagaattagcccaagccagagat
gaaaccaagaaaacacaaaatgatgttcttcatgctgagaatgttaaagcaggccgtgat
aagtacaagactctgcgacagattcgacaaggcaatacaaagcagcgtatcgatgagttt
gaagcaatgtga

DBGET integrated database retrieval system