KEGG   Homo sapiens (human): 5966Help
Entry
5966              CDS       T01001                                 

Gene name
REL, C-Rel
Definition
v-rel avian reticuloendotheliosis viral oncogene homolog
Orthology
K09254  
c-Rel proto-oncogene protein
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Transcriptional misregulation in cancer
Viral carcinogenesis
Disease
H00007  
Hodgkin lymphoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5966 (REL)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    5966 (REL)
   05203 Viral carcinogenesis
    5966 (REL)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    5966 (REL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p13-p12
AA seq 587 aa AA seqDB search
MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGK
VRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAII
TRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV
AIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLF
QKLCQDHVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPG
PISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVG
NDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNP
RLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADN
SMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQV
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcctccggtgcgtataacccgtatatagagataattgaacaacccaggcagagggga
atgcgttttagatacaaatgtgaagggcgatcagcaggcagcattccaggggagcacagc
acagacaacaaccgaacatacccttctatccagattatgaactattatggaaaaggaaaa
gtgagaattacattagtaacaaagaatgacccatataaacctcatcctcatgatttagtt
ggaaaagactgcagagacggctactatgaagcagaatttggacaagaacgcagacctttg
tttttccaaaatttgggtattcgatgtgtgaagaaaaaagaagtaaaagaagctattatt
acaagaataaaggcaggaatcaatccattcaatgtccctgaaaaacagctgaatgatatt
gaagattgtgacctcaatgtggtgagactgtgttttcaagtttttctccctgatgaacat
ggtaatttgacgactgctcttcctcctgttgtctcgaacccaatttatgacaaccgtgct
ccaaatactgcagaattaaggatttgtcgtgtaaacaagaattgtggaagtgtcagagga
ggagatgaaatatttctactttgtgacaaagttcagaaagatgacatagaagttcgtttt
gtgttgaacgattgggaagcaaaaggcatcttttcacaagctgatgtacaccgtcaagta
gccattgttttcaaaactccaccatattgcaaagctatcacagaacccgtaacagtaaaa
atgcagttgcggagaccttctgaccaggaagttagtgaatctatggattttagatatctg
ccagatgaaaaagatacttacggcaataaagcaaagaaacaaaagacaactctgcttttc
cagaaactgtgccaggatcacgttaattttcctgagagaccaagacctggtctcctcggt
tcaattggagaaggaagatacttcaaaaaagaaccaaacttgttttctcatgatgcagtt
gtgagagaaatgcctacaggggtttcaagtcaagcagaatcctactatccctcacctggg
cccatctcaagtggattgtcacatcatgcctcaatggcacctctgccttcttcaagctgg
tcatcagtggcccaccccaccccacgctcaggcaatacaaacccactgagtagtttttca
acaaggacacttccttctaattcgcaaggtatcccaccattcctgagaatacctgttggg
aatgatttaaatgcttctaatgcttgcatttacaacaatgccgatgacatagtcggaatg
gaagcgtcatccatgccatcagcagatttatatggtatttctgatcccaacatgctgtct
aattgttctgtgaatatgatgacaaccagcagtgacagcatgggagagactgataatcca
agacttctgagcatgaatcttgaaaacccctcatgtaattcagtgttagacccaagagac
ttgagacagctccatcagatgtcctcttccagtatgtcagcaggcgccaattccaatact
actgtttttgtttcacaatcagatgcatttgagggatctgacttcagttgtgcagataac
agcatgataaatgagtcgggaccatcaaacagtactaatccaaacagtcatggttttgtt
caagatagtcagtattcaggtattggcagtatgcaaaatgagcaattgagtgactccttt
ccatatgaattttttcaagtataa

DBGET integrated database retrieval system