KEGG   Homo sapiens (human): 5966Help
Entry
5966              CDS       T01001                                 

Gene name
REL, C-Rel
Definition
v-rel avian reticuloendotheliosis viral oncogene homolog
Orthology
K09254  
c-Rel proto-oncogene protein
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Transcriptional misregulation in cancer
Viral carcinogenesis
Disease
H00007  
Hodgkin lymphoma
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p13-p12
AA seq 619 aa AA seqDB search
MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGK
VRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAII
TRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV
AIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLF
QKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYF
KKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTP
RSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSA
DLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMS
SSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGI
GSMQNEQLSDSFPYEFFQV
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggcctccggtgcgtataacccgtatatagagataattgaacaacccaggcagagggga
atgcgttttagatacaaatgtgaagggcgatcagcaggcagcattccaggggagcacagc
acagacaacaaccgaacatacccttctatccagattatgaactattatggaaaaggaaaa
gtgagaattacattagtaacaaagaatgacccatataaacctcatcctcatgatttagtt
ggaaaagactgcagagacggctactatgaagcagaatttggacaagaacgcagacctttg
tttttccaaaatttgggtattcgatgtgtgaagaaaaaagaagtaaaagaagctattatt
acaagaataaaggcaggaatcaatccattcaatgtccctgaaaaacagctgaatgatatt
gaagattgtgacctcaatgtggtgagactgtgttttcaagtttttctccctgatgaacat
ggtaatttgacgactgctcttcctcctgttgtctcgaacccaatttatgacaaccgtgct
ccaaatactgcagaattaaggatttgtcgtgtaaacaagaattgtggaagtgtcagagga
ggagatgaaatatttctactttgtgacaaagttcagaaagatgacatagaagttcgtttt
gtgttgaacgattgggaagcaaaaggcatcttttcacaagctgatgtacaccgtcaagta
gccattgttttcaaaactccaccatattgcaaagctatcacagaacccgtaacagtaaaa
atgcagttgcggagaccttctgaccaggaagttagtgaatctatggattttagatatctg
ccagatgaaaaagatacttacggcaataaagcaaagaaacaaaagacaactctgcttttc
cagaaactgtgccaggatcacgtagaaacagggtttcgccatgttgaccaggatggtctt
gaactcctgacatcaggtgatccacccaccttggcctcccaaagtgctgggattacagtt
aattttcctgagagaccaagacctggtctcctcggttcaattggagaaggaagatacttc
aaaaaagaaccaaacttgttttctcatgatgcagttgtgagagaaatgcctacaggggtt
tcaagtcaagcagaatcctactatccctcacctgggcccatctcaagtggattgtcacat
catgcctcaatggcacctctgccttcttcaagctggtcatcagtggcccaccccacccca
cgctcaggcaatacaaacccactgagtagtttttcaacaaggacacttccttctaattcg
caaggtatcccaccattcctgagaatacctgttgggaatgatttaaatgcttctaatgct
tgcatttacaacaatgccgatgacatagtcggaatggaagcgtcatccatgccatcagca
gatttatatggtatttctgatcccaacatgctgtctaattgttctgtgaatatgatgaca
accagcagtgacagcatgggagagactgataatccaagacttctgagcatgaatcttgaa
aacccctcatgtaattcagtgttagacccaagagacttgagacagctccatcagatgtcc
tcttccagtatgtcagcaggcgccaattccaatactactgtttttgtttcacaatcagat
gcatttgagggatctgacttcagttgtgcagataacagcatgataaatgagtcgggacca
tcaaacagtactaatccaaacagtcatggttttgttcaagatagtcagtattcaggtatt
ggcagtatgcaaaatgagcaattgagtgactcctttccatatgaattttttcaagtataa

DBGET integrated database retrieval system