KEGG   Homo sapiens (human): 5972Help
Entry
5972              CDS       T01001                                 

Gene name
REN, HNFJ2
Definition
renin (EC:3.4.23.15)
Orthology
K01380  
renin [EC:3.4.23.15]
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
Disease
H00541  
Uromodulin-associated kidney diseases
H00575  
Renal tubular dysgenesis
Drug target
Remikiren: 
Aliskiren: 
Other: 
Class
Organismal Systems; Endocrine system; Renin-angiotensin system [PATH:hsa04614]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32
AA seq 406 aa AA seqDB search
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEW
SQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRL
YTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEM
PALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGG
QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG
STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggatggatggagaaggatgcctcgctggggactgctgctgctgctctggggctcctgt
acctttggtctcccgacagacaccaccacctttaaacggatcttcctcaagagaatgccc
tcaatccgagaaagcctgaaggaacgaggtgtggacatggccaggcttggtcccgagtgg
agccaacccatgaagaggctgacacttggcaacaccacctcctccgtgatcctcaccaac
tacatggacacccagtactatggcgagattggcatcggcaccccaccccagaccttcaaa
gtcgtctttgacactggttcgtccaatgtttgggtgccctcctccaagtgcagccgtctc
tacactgcctgtgtgtatcacaagctcttcgatgcttcggattcctccagctacaagcac
aatggaacagaactcaccctccgctattcaacagggacagtcagtggctttctcagccag
gacatcatcaccgtgggtggaatcacggtgacacagatgtttggagaggtcacggagatg
cccgccttacccttcatgctggccgagtttgatggggttgtgggcatgggcttcattgaa
caggccattggcagggtcacccctatcttcgacaacatcatctcccaaggggtgctaaaa
gaggacgtcttctctttctactacaacagagattccgagaattcccaatcgctgggagga
cagattgtgctgggaggcagcgacccccagcattacgaagggaatttccactatatcaac
ctcatcaagactggtgtctggcagattcaaatgaagggggtgtctgtggggtcatccacc
ttgctctgtgaagacggctgcctggcattggtagacaccggtgcatcctacatctcaggt
tctaccagctccatagagaagctcatggaggccttgggagccaagaagaggctgtttgat
tatgtcgtgaagtgtaacgagggccctacactccccgacatctctttccacctgggaggc
aaagaatacacgctcaccagcgcggactatgtatttcaggaatcctacagtagtaaaaag
ctgtgcacactggccatccacgccatggatatcccgccacccactggacccacctgggcc
ctgggggccaccttcatccgaaagttctacacagagtttgatcggcgtaacaaccgcatt
ggcttcgccttggcccgctga

DBGET integrated database retrieval system